KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_4227Help
Entry
N296_4227         CDS       T03170                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N296_4227
Enzymes [BR:paei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     N296_4227
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     N296_4227
    1.1.1.-  
     N296_4227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: AGY64991
LinkDB All DBs
Position
4580590..4581648
Genome map
AA seq 352 aa AA seqDB search
MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLS
GCRAPLTLGHEFCGVVAALGPGVEGPRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFI
GLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGL
GPIGLLLVMLARLRGIEDIAAVDVSPERLALAGEFGASRALDARDGDTAARLREGGALDC
AFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLVNRELRLLGSVGYRDAYPEL
IALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQLKVLVNPNPALADA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctggcacgccgcccgcgacctccgcctgagcgaactggaacgccag
gcgccgcggcccggcgaagtcgaactggaagtcgcctactgcggcatctgcggcagcgac
ctgcacgaataccagagcggcccgcactcgattccccaggccgaggcgcacccgctgtcc
ggttgccgcgcgccgctgaccctcggccatgagttctgcggcgtggtcgccgcgctcggc
cctggcgtggagggaccgcgcatcggcgaccgcgtcgcggtggagccggaataccgctgc
ggcgaatgccgctactgccgggaaggccgctacaacctctgcgagtcgatgggcttcatc
ggcctgatgggcgacggcggcttcgccgagcgcgcgcgggtgccggcctacatgctgcac
cgcctgccggacgcggtgggcttccgccaggccgccgtgctcgaaccggccgccgtggcc
ctgcacgcgctgcgccgcagcagcctggcgccgggccagcgctgcgcggtgttcgggctt
ggcccgatcggtctgctgctggtgatgctcgcccgcctgcgcggaatcgaggacatcgcc
gcggtcgacgtcagtcccgagcgcctcgccctagccggcgaattcggcgccagccgggcg
ctcgacgcccgtgacggcgacacggcggcgcgcctgcgcgaaggcggcgcgctcgattgc
gccttcgaggccgccggcagccaggccagcctcgacgccgccctggccagcctgcgcaag
ggtggcgagctggtgctggtgagcctgatgggcgaggtcaggctggacgccttcgacctg
gtcaaccgcgaactgcgcctgctcggcagcgtcggctaccgcgacgcctacccggagctg
atcgccctgctcgccgatggccgcctcgacctggcccgcgcagtgacccgcagcgtgccc
ctggagcaggccgtcgagcacggtttcgaggccctgctgcgcgacaaatcgcagctcaag
gtgctggtcaatcccaacccggccctggccgacgcctga

DBGET integrated database retrieval system