KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_4333Help
Entry
N296_4333         CDS       T03170                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei00473  D-Alanine metabolism
paei00550  Peptidoglycan biosynthesis
paei01100  Metabolic pathways
paei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N296_4333
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N296_4333
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    N296_4333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paei01011]
    N296_4333
Enzymes [BR:paei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N296_4333
Peptidoglycan biosynthesis and degradation proteins [BR:paei01011]
 Precursor biosynthesis
  Amino acid ligase
   N296_4333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD GARS_A ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AGY64296
LinkDB All DBs
Position
complement(4701986..4703026)
Genome map
AA seq 346 aa AA seqDB search
MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLA
SKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAY
TGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEEVREQLGFPLVVKPNSQGSTV
GLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFD
YEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEV
NTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggacaagttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggac
gtctccatcgccagcggcgcgcaggtgatccaggctttgcgcagcgccggccaccaggtg
ctggcggtggataccgccagcggcctgctcggcgcggaggaagagcgccgcctgctggcg
agcaaggtcaaggaggtcccgccggactccgactcgctggcgatcatccgcagcggcaag
cagagcctgctgagcgccggcgaactggctggggtcgacgtgttcttcctcgccctgcac
ggcggcaccggcgaggacggcaccctgcaggcgctgctggatgccggtggtttcgcctat
accggcagcggccacctggccagcgccatggcgatggacaaggacgtggccaagcgcctg
ttcctcgccgccggggtggagaccgccagttggctgatggcgccggcctcggaagaggag
gtgcgcgagcaactgggcttccccctggtggtcaagccgaacagccagggctccaccgtg
gggctgtccatcgtgcattcccaggccgaattgcagccggccatcgagctggccgggcgc
tatggcgacgaggtgatgctggagcgcttcgtcgccggccgcgaggtcaccgtcggggtg
ctcgacgaccaggcgctgccggtgggcgagattctcctcggcggccaggaggtcttcgac
tacgagcacaagtaccaggccggcgcggtgcgcgaggtgtttcccgccgacctgccgccg
gcgatcgccgccgaggcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagc
ggctacagccgcaccgacttccgcctcgacgaacagggccggctctggtgcctggaggtc
aataccctgccgggcatgaccgccaccagcctgctgccgcaggccgcggcggcggccggg
atcggtttcgccgaactctgcgagcggatctgccggctcggcatcgagcgctgcaagggc
gcgcgcaaggcgcgttcctga

DBGET integrated database retrieval system