KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_4510Help
Entry
N296_4510         CDS       T03170                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Brite
Enzymes [BR:paei01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N296_4510 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGY64847
LinkDB All DBs
Position
4894777..4895358
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgaaaagaacgcccttgagccgcacatttcc
gcagaaaccctggaataccaccacgacaagcaccacaacacctacgtggtgaacctgaac
aacctgatcccgggcaccgagttcgaaggcaagagcctcgaagagatcgtcaagagctcc
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggaactgc
ctgagcccgaacggcggtggccagcccaccggcgccctggccgacgccatcaacgccgcc
ttcggctccttcgacaagttcaaggaagagttcaccaagacttccgtcggcaccttcggt
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggtgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggacttcgtagcgaagaatttcgctgcctga

DBGET integrated database retrieval system