KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_80
Entry
N296_80           CDS       T03170                                 

Definition
(GenBank) phosphotransferase enzyme family protein
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei02025  Biofilm formation - Pseudomonas aeruginosa
paei03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    N296_80
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    N296_80
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paei01001]
    N296_80
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paei02044]
    N296_80
Enzymes [BR:paei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     N296_80
Protein kinases [BR:paei01001]
 Serine/threonine kinases: Other
  Bacterial family
   N296_80
Secretion system [BR:paei02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   N296_80
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr VWA APH VWA_2 TssR Pkinase_fungal Kdo Kinase-like
Other DBs
NCBI-ProteinID: AGY66269
LinkDB
Position
complement(87000..90098)
AA seq 1032 aa
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTL
ARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPEQGLAYVRQVAAALGYA
HSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEPLPELPIEQGRYQDILRQL
LAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGSPRASNPPPAEPAPLPPADL
GGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGGSRTPLIAAAA
AAVLLAIGGGAWWLLGSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDG
WLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDP
QVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAG
QGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGF
RNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDE
MDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNN
HGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLS
KLQLNELQQSLKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGE
YLEGLPYRSKSLNMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAG
DALYRVPLSTLP
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggacatagaacttccgggattcgacatcgaacgcgagctgggcgaaggcgccatggcc
acggtctacctggccacccagcgctcgctgcagcgcaaggtggcgctgaaggtgatggcc
gcggcgctggccgccgacccgagcttcgccgaacgcttcctgcgcgaaggtcggaccctg
gcgcggctgtcgcacccgaacacggtgaccatccacgacatcggcaacgtcggcagttgc
tactacatggccatggaatacctgcccaacggcacgctcaaggagcgcatccagcagggc
ctcgatcccgagcagggcctggcctacgtacggcaggtggccgccgcgctcggctacgcg
cactcccagggcctggtgcatcgcgacgtgaagccggccaacatcctgttccgcgccgac
ggcaccgcggtgctctcggacttcggcatcgccaagtcgatcgaggacaatacccagttc
acccaggtcggcttcgccgtcggcacccccagctacatgagcccggagcaggcccgcggg
caggagatcgacggccgcgccgacctctacgcgctgggcgtggtgctctacgagatcctc
accggcaagctgccctacaacggcaaggactcgctctccaccgccctggcccacctcacc
gagccgctgccggaactgccgatcgagcagggccgctaccaggacatcctgcgccagttg
ctggccaaggacccggccgagcgcttccccaccgccggcgcgttgatcgccgccctcgac
cgcctggcgccgagcgccctggaagccacccagatccgtccgctggcgacgccgcagggc
tcgccgcgagcgagcaacccgccgccggccgaacccgcgcccctgccgcccgccgacctc
ggcggcctgcaaccggtgtcgatccagttgccgccggtcacgcccagcgccggcggcgcc
acgccgcctccgcctccgccgtcgcaagcggcgaaaccgccatcgcccccgccgcctccg
ttgccgccggcgaagccacgtgccggcggcagccgcacgccgttgatcgccgccgccgcg
gccgccgtgctcctggcgatcggcggcggcgcctggtggctgctgggctcgggcgacgcg
ccgagcgctgccgatccagcgccgctgggacagacgccggcggacaagccgcagcagcag
accccggtggccgatgccgaacaggacggcggcgagcgtccgctgctgatgccaggcaag
aagacgctgttccagcgcgtcctgaccaaacccggcgcggccatctccgccgaggctggc
ggcccgccccgggccggcgcggtgccggccttctcggtgctctacgtgtacgcccgcaag
caggtcggcggcagcccctggctgcgcgtcggcgcctccagcaacggcgagggcgacggc
tggctgccggctagcgcggtgagcgactggaagcagagcctggtgctgaagttcaccgaa
cgctccggccgcgcgccggtgatgttcctcaacagcgccgagcaggtcgagcgcctgctc
ggcgatacccgcgcagcgcgcgacaccctgacccaggcggtggatcacaagggcgatccg
caggtggtcgcggtcgagcccaacgaccgggcgatcccccaggaccagttctacctgctg
ccgatcttcgactcgaaggaaagcttcgacgccgacggccagccggcgcagttgctggag
gtcgcctcgatcgaccccggcggcagcgccgcggcaccccaggcgccgggccaggccggg
cagggcggcgccagcggcgcggcgagcgacaccttccgcaccggcatcgtcctggtggtg
gacacctcggtgtcgatgcagccctacatcgaccgcgtgcgcgaggtgatcgacggcctg
cagcggcagatcggcgagcgcggcgacctggacaaggtcagcttcggcctggtcggtttc
cgcaacaacaccgacaagacccccggcctggaatacgtcagcaagaccctggtgccgctg
caaccgggcaacgacgcgcagcgcttcgccgagttgagcagccaggtgcgcgccaccgac
gtctccagccactcgttcaacgaagacgccttcgccgggatcatgcaggcggtcgacgaa
atggactggtcgccctacgccgggcgcgtggtgctgctggtcaccgacgccggcgcgctg
cgcaagaacgacccgctcgggcgcacccagatgaacgaggccgaggtccgccaggcggcg
ctgcgcaagggcgtgaagatctatgccctgcacctgcgcaccccggccgggaagaacaac
cacggctacgccgagcagcagtaccgcagcctcaccgccgacgccaacccgaagatcgcc
gacctctacatcccggtggccggcggcgaggtgaacgccttcggcaacacggtgaaggag
atcggcacggtgttcgccgacctggtccacgacgccggcaaccgcaagccgcaggcgccg
cgcttcgacgccgcgccaagcgtggcgagcaagtcggcggccatcggctacgccatgcag
atggaattcctcggtcgccgcgacccggtgcgcgcgccgcaggtcgtcaccgcctggacc
gccgaccgtgacctgaccaacccggcgctgccggcgttccaggtctgcgtgctgctgagc
aagctgcaactcaacgaactgcaacagtcgctgaaactgatcgtcgacgcggccaagcgc
acccagacctcgcccaaggacttcttccaggaaatcgccagcgccagcgcctacatgagc
cgcgacccggcgcaactggtgaagggcagcaacctggcgcagagcggcgtactcggcgaa
tacctggaaggcctgccgtaccgcagcaagtcgctgaacatgacccaggacctctggctg
tcgctgagcgtcgccgaacagcaggacttcatcgacgaactggagtcgaagatccgcctc
tacgaaaccttccacaacgacgtcgccaactgggtccggttcggcgacgccgacgccggc
gacgcgctgtaccgcgtgccgctgtcgacgctgccatga

DBGET integrated database retrieval system