KEGG   Paenibacillus sp. FSL H7-0737: H70737_11705Help
Entry
H70737_11705      CDS       T03359                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paej01100  Metabolic pathways
paej01110  Biosynthesis of secondary metabolites
paej01130  Biosynthesis of antibiotics
paej01230  Biosynthesis of amino acids
Module
paej_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H70737_11705
Enzymes [BR:paej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     H70737_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 CoaE AAA_17 Cytidylate_kin dNK AAA
Motif
Other DBs
NCBI-ProteinID: AIQ23459
UniProt: A0A089JR90
LinkDB All DBs
Position
2677217..2677708
Genome map
AA seq 163 aa AA seqDB search
MILVGMMATGKSTVGAILAEELGYELVDLDHVIVETEGRSIAEIFAEDGEHYFRSVETAV
LKRMLESENKLISTGGGAVLAPGNTDLMLSKGHVVALTATEEEIIARVSGDQNRPLLAGN
AEERVRRIMEDRREAYLFAHYTVDTTGLTAAEVSQYILMHYRG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
attattttagtagggatgatggcaactgggaagtcaacagtaggcgcaattttggccgag
gaactgggttacgagctggttgatctggatcatgtcattgttgaaactgaaggccgaagt
attgcagaaattttcgcggaagatggagagcattactttcgaagcgtggaaacagcagta
ctaaagcgtatgctagagtctgagaataaattaatatctactggtggtggcgcggtattg
gcgccggggaatacagatttaatgctgagtaaagggcatgtggttgcgctaacggcaaca
gaagaagagattattgcccgcgttagtggagatcagaatcgtccgctgctcgccggcaat
gcagaagaacgggttagacgtatcatggaagaccgtcgagaagcttacctgttcgcgcat
tacacggtcgatacaacgggactgacagcggcagaagtgtcgcaatatattttaatgcat
taccgcggctga

DBGET integrated database retrieval system