KEGG   Paenibacillus sp. FSL H7-0737: H70737_11975Help
Entry
H70737_11975      CDS       T03359                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
paej  Paenibacillus sp. FSL H7-0737
Brite
KEGG Orthology (KO) [BR:paej00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paej01001]
    H70737_11975
Enzymes [BR:paej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     H70737_11975
Protein kinases [BR:paej01001]
 Serine/threonine kinases: Other
  Bacterial family
   H70737_11975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo Haspin_kinase FTA2 DUF3899 Pkinase_fungal Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AIQ23511
UniProt: A0A089IGN2
LinkDB All DBs
Position
2738323..2740590
Genome map
AA seq 755 aa AA seqDB search
MIGHELGGRYQVIERIGGGGMALVYRAHDILLNRNVAIKVLRNQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEIHYIVMEYIEGKNLNEIIKERAPLQVDESVRIASQICDA
LDHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVSTGEKSDLYSLGIVLYQMLTGSLPFLGESPISVALKHLQEEFEEPRLINPLIPQSV
ENVILRSMRKNPEERYQSAKQMLQDLETCLLPERRSEAKVLFNDEEDEDRTRVIPAIKPI
QRSNGNRNHRHDRMDNDEDDDDDPVPVKKGKKQWTKPALWIGLTLVLLLAMASLVWYVKS
QLVVPEVSVPYVVGKQLEQAKTELEDLGLEVADPILYDYSPNFEENVVMKQSREKDAKVK
KGASLILTVNTAKPLTKMPDVTNLSFDEAVKALMAKGVPQNQIKNEPLFDENTAVGKVVK
SDPAFDSEFDPESVSIILYVSKGEESVTMPDLIGKTESEAKALLEESKLVLGDVKEESSF
TVDEGKVTKTWAYEKGTSVPPGTAITIYLSTGYPPEALNYTFNVPVAPAQDGKKSKIRIE
FVDARNNGEKQDWGTRTIGKSQVLSVNLVLAPNKDGSVIVTRDGVLLDTYVIPYIDAKNG
TVQEPEPPTIPTPQPTQTPIDPTPTAEPTIEPEILPPSSDNEGSTNTGSANQTGFLTNNS
VNNESTNSGNNKNSNKNGDKHNNKNKDKSKDKSDN
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcacgaactgggcggccgttaccaagtcatcgaacggatcggcggaggtgga
atggcgctcgtctatagagcacatgacattcttttaaaccgaaacgtcgccatcaaagta
ttgcgtaatcaatttgttcatgacgaggaatttatccgccgttttaggcgtgaggcgcaa
tcagctgcatctttgtctcatccgaatgtggttagtatttacgatgtaggacaagaagac
gaaattcattatattgtcatggaatatattgagggcaagaatcttaatgaaattataaaa
gaacgagcgccattacaggttgacgagtccgtaaggatcgcttcacaaatctgtgatgca
cttgatcacgctcatcagaatcaaattattcatcgggatattaaaccacataatatattg
atcgggcgcaatggccgggtgaaggtaacggatttcggtattgctcgtgcggtaacatct
actaccattactcagacaggctctgtagtaggttccgttcattatttctcaccagagcat
gccaaaggtgtctcaacaggagagaaatccgacctgtattcattagggattgtactctat
caaatgcttaccggaagtcttccattcttaggggagagtccgattagcgtagctctaaag
catctgcaagaagagtttgaagagccaaggctcataaatccacttattccgcaaagcgtt
gagaatgtaattctaagatcgatgcgtaaaaatccggaagagcgttatcagtctgcaaag
caaatgctgcaggatttagaaacctgcttgttgcctgagcgccgtagtgaagcaaaagtt
ctttttaacgatgaggaagacgaggatcgaacgcgggtaataccagcgattaaaccgatc
caaagaagcaatggaaatcgtaatcatcgccacgaccggatggataatgatgaagatgat
gatgacgatccggtacctgtgaaaaaaggtaaaaaacaatggactaaacctgcattatgg
attggtttaactttagtgttactgctggctatggccagtctcgtgtggtacgttaaatcc
caattagttgttcctgaggtatcggttccttacgtggtcggtaaacagctggaacaagcg
aagactgaacttgaggatttggggcttgaggttgctgatcctatactgtatgactacagt
ccgaatttcgaagagaatgtggtcatgaagcaaagtagggaaaaggacgccaaagtgaaa
aagggagcctccctaatactaactgtgaatacggcgaaaccattaactaagatgccagat
gttacaaatttaagctttgacgaagcggttaaagcgctgatggcaaagggtgtaccccag
aatcaaattaagaatgaacctctcttcgatgaaaatacggcggtgggtaaggttgtaaaa
tcagacccagcctttgacagcgagtttgatcctgagtcggtttcaatcatcctctacgtt
agcaaaggagaagaaagtgtcacgatgccagacctcatcggtaagacggagagtgaagct
aaggcgcttttggaagaatccaaactggtcctcggagatgtaaaggaagaatccagcttc
acagttgatgaaggtaaggtaacgaaaacttgggcttatgagaaaggtacctctgttcca
cctggaacagcgattacgatttacttaagtacaggttatccacctgaagccctgaattat
acctttaatgtaccagtagctcctgcacaggatggaaagaagagcaagattcgaattgag
ttcgttgatgcgcgcaataatggtgagaaacaagattggggaacgcgtaccattggaaag
agccaagtgctgtccgttaatctagtgcttgctccgaataaagatggctctgttattgtt
acccgagatggtgtgcttttagacacttatgtgattccatatattgatgcgaagaatggc
acggtgcaagaacctgaaccaccgacgattccgactccgcagccgactcagacaccgata
gatcctacacctactgctgaaccgaccattgagcctgagatcctgcctccaagttcagac
aacgaagggtctactaatactggatcagccaatcagacgggattccttactaacaattcg
gtgaataatgaatcgaccaatagtggtaacaacaagaacagtaataaaaatggtgacaag
cataataataaaaacaaagacaaatctaaagataaaagcgataactaa

DBGET integrated database retrieval system