KEGG   Paenibacillus sp. FSL H7-0737: H70737_13770Help
Entry
H70737_13770      CDS       T03359                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    H70737_13770
Enzymes [BR:paej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     H70737_13770
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     H70737_13770
    1.1.1.-  
     H70737_13770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Shikimate_DH TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AIQ23843
UniProt: A0A089IMW8
LinkDB All DBs
Position
complement(3091699..3092751)
Genome map
AA seq 350 aa AA seqDB search
MQALRWHNVKDLRLETIEEPAALEGKVKIKIEWCGICGSDLHEYVAGPIFIPQGTDHPLT
GEKAPVVMGHEFSGQIVEVGQGVSKFNVGDRVVVEPVFACGECVACRQGKYNLCEKMGFL
GLAGGGGGFSEYVAADQHMVHKIPDSLSYEQGALVEPSAVALHAVRSSQLKVGDKAVVFG
AGPIGLLVIEALKASGAAEIYVVELSEERKSKAEELGGIVIDPKQYDVVEEIQKRTDGGV
DVAFEVTGVPPVLTQAINSTKLSGQIMIVSIFEKDATITPNNIVLKERNLTGIIGYRDVF
PAVISLMEQGYFPADKLVTKRIKLNEVIEHGFEALLKEKNQVKILVSPKQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattaagatggcataacgtcaaagatctacggttagaaacgattgaagaacca
gcagcacttgaagggaaagtgaaaatcaaaatagaatggtgcgggatttgtggcagcgat
cttcacgaatatgtagccggtcctattttcattccccaaggtacagatcatccccttact
ggtgaaaaagcgccagtcgtaatgggacatgaattctctggacaaatcgttgaagtaggt
caaggcgttagcaagtttaatgttggtgatcgagttgtcgttgaaccagtttttgcatgt
ggtgaatgtgtagcttgtcgacaaggcaaatacaatctttgtgaaaaaatgggcttccta
ggtttggctggaggcggcggtggattctcagaatacgttgcagcagaccaacatatggtg
cacaaaattcctgacagcttgtcctatgagcaaggcgctctagtagaaccttctgcagtt
gctctgcatgctgttcgttccagtcaattgaaggtcggagataaggctgtagtatttggc
gctggtcctatcggtttgcttgtgattgaagctttgaaagcttccggtgcagctgaaatt
tatgttgttgaactctcagaagaacgtaaaagcaaagctgaggaacttggtggtattgta
atcgatcctaaacaatatgatgtggttgaagaaattcaaaaacgtaccgatggcggcgtg
gatgttgcttttgaagtcacaggtgtccctcccgttctaacacaagctatcaattccact
aaattaagtggtcaaatcatgatcgttagtatttttgaaaaagatgctacgattactcca
aacaacatcgtacttaaagaacgtaatttaactggtatcatcggataccgtgatgtattc
ccagcagtaattagtctcatggaacaaggttacttccctgcagacaaactagtgactaaa
agaatcaaattgaacgaagtgattgaacacgggtttgaggcgcttttgaaggaaaaaaat
caagtgaaaattcttgtaagtcctaaacaataa

DBGET integrated database retrieval system