KEGG   Paenibacillus sp. FSL H7-0737: H70737_14345Help
Entry
H70737_14345      CDS       T03359                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00627  Aminobenzoate degradation
paej01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H70737_14345
Enzymes [BR:paej01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     H70737_14345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIQ23943
UniProt: A0A089IN84
LinkDB All DBs
Position
3219930..3221384
Genome map
AA seq 484 aa AA seqDB search
MNYSELGKQFIGGEWREGKSSKTLTDINPYNDDVIHTFQIASVVDIDDAYQAAYKAKLEW
DKVNPYIKRDILENAVKYIEANEEEITSIIVKELGGTRLKAAFEIGLVKNMVKEAATFPL
RMEGKILPSTEDGKENRLYRIPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHED
SPITGGTLIGKIFEEAGVPKGLLNVVVTDIKEIGDAFVEHPIPRIISFTGSTKVGSYIGQ
LAIKNFKKPLLELGGNSAFIIMEDADLDYAVQAATFSRFTHQGQICMSANRIIVHKTIYQ
DFVNKFKEKVSTLTTGDPSDPQTIIGPVINHRQAETLEKLIAKGIEQGAVPLLHGKITGR
MVEPTILINVKTDMAVAQEELFGPVVCIIPFETDEEAIEIANDTRFGLSGAIHTSNLERG
VEMAKKVHTGMVHVNDVTINDEPIVAFGGEKQSGIGRLNGKWSLDEFTTMKWISVNYGQR
KLPY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaactattcagaactaggaaaacaatttataggtggggaatggagagaagggaagagt
agtaaaacactgacagacatcaatccatataatgatgatgtaatccatacttttcaaatt
gcaagcgttgttgacattgacgatgcttatcaagcagcttataaagcaaagctggaatgg
gataaggttaacccgtatattaaacgtgacatccttgagaacgctgttaaatatattgaa
gcgaatgaggaagaaattacatccattattgttaaggaactgggtggaacgaggctgaag
gcagcatttgagattggtcttgtaaaaaatatggtaaaagaagcggcaacgttcccactt
agaatggagggtaagatcctgccttctacagaggatggtaaggagaatcggctgtaccgc
atccctgcaggcgtggttggggtgattagtccttttaactttcctttcttcttgtctatg
aagtcggttgctcctgcgctgggtgctggaaatggtgtggtacttaaaccacacgaggat
tcacccattacgggtggaactctgatcggcaaaatttttgaagaagcaggtgtaccgaag
gggctattaaatgttgtagtgacggatataaaggagattggcgacgcgttcgtcgagcat
ccgattccgagaatcatttccttcacgggttcgactaaggttggaagctatataggtcaa
ctggcaatcaagaacttcaaaaagccgttacttgagcttggcggcaatagcgcgttcatt
atcatggaagatgcggatctcgactacgcagtacaagctgcgacattcagcagattcaca
catcaaggtcagatttgtatgtctgccaacagaatcattgtacataagacgatctatcag
gattttgtaaataaattcaaagagaaggtatctacacttacaacaggtgatccgagtgat
ccacagaccatcattggaccagtcatcaaccaccgccaagcagagacactggaaaagtta
attgctaagggcatagaacaaggcgctgttcctctgttgcatggtaagattaccggccga
atggtagagcctactatccttattaatgttaaaacggatatggctgttgcacaagaggag
ctgttcggaccagttgtatgtatcattccgttcgaaacggatgaggaagctattgaaatt
gccaacgatacgcgttttgggctaagcggagcaattcatacctccaatcttgagcgtggt
gtagaaatggctaagaaggtccacactggaatggttcatgtgaatgatgtcacgattaac
gatgagccgattgtagctttcggaggagagaaacagtccggtataggccgtttaaatggg
aaatggagcttggatgaatttacaacgatgaaatggatttcagttaattatggacaaaga
aaactcccttattaa

DBGET integrated database retrieval system