KEGG   Paenibacillus sp. FSL H7-0737: H70737_16680Help
Entry
H70737_16680      CDS       T03359                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00010  Glycolysis / Gluconeogenesis
paej00020  Citrate cycle (TCA cycle)
paej00620  Pyruvate metabolism
paej01100  Metabolic pathways
paej01110  Biosynthesis of secondary metabolites
paej01120  Microbial metabolism in diverse environments
paej01130  Biosynthesis of antibiotics
paej01200  Carbon metabolism
Module
paej_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H70737_16680
   00020 Citrate cycle (TCA cycle)
    H70737_16680
   00620 Pyruvate metabolism
    H70737_16680
Enzymes [BR:paej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     H70737_16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NQRA RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AIQ24343
UniProt: A0A089IPA6
LinkDB All DBs
Position
complement(3761676..3763322)
Genome map
AA seq 548 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKAGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
LTKDGQVCRVGEVVAIIEAEGDVPEQEGHAAEEAAPAPAAPAPANAKSANFEYRFPELGE
GLHEGEIIKMHIKAGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVLEVLTKDGQVCRVGDV
VAIIAAEGDVPEQAGHASAEADAAKGSANTTSSPAATSPSDAKQGGSVSAAPAPDRDVLA
TPSVRKFAREQKVDISKVNGTGKGGKITREDVEAFLKGGSAPAAAATPAAAASEAPKAAK
TEAKATSAAASGNVSLEEERVPYKGIRKAIANAMVKSAYTAPHVTIMDEVDVTELVAFRT
RMKPIAEKKGVKVTYLPFIVKALVAASRQFPALNAMIDEEAGEIVYKKYYNIGIATDTPN
GLIVPVIKDADRKSIWMIASSITDLAVRGRDGKLSANEMKGSTISISNIGSAGGMFFTPI
INFPEVAILGTGRISEKAVVKNGEIVVAPVMALSLSFDHRIIDGATAQNFMNYIKSLLNN
PELLVMEV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaagtttgaataccgattccctgaactaggtgaaggtttgcatgaaggtgaaatc
atcaaaatgcatatcaaagccggtgacaaggtaacggatgatgatatcgtaatggaagtt
caaaatgataaggcggtagttgaggtgccttgtccagtgaacggtaccgtgttggaagtt
ttgactaaagatggccaagtttgccgtgttggcgaagttgtagctattatcgaagctgag
ggcgacgtgcctgagcaagaaggtcatgctgctgaagaagctgcacctgcacctgctgca
ccagctcctgcgaatgctaaatcagcgaactttgaatatcggttcccagaactgggtgaa
ggtctgcatgaaggtgaaatcatcaaaatgcatatcaaagccggtgacaaagtaaccgat
gatgatatcatcatggaagttcaaaatgacaaggcagtagttgaagttccttgtccagtg
aacggtactgtgttggaagttctgactaaagatggtcaagtatgccgtgttggcgatgtt
gtagctatcattgctgcagaaggtgacgttcctgaacaagcaggtcatgcttccgcagaa
gcagatgcagcaaaaggaagtgcaaataccacttcttcccctgcagcaactagcccatct
gatgctaaacaaggtggatctgttagtgcagcacctgcgcctgaccgtgatgtgttggct
acaccaagcgttcgtaaatttgctcgtgagcaaaaagtggatatctctaaagtgaacgga
actggaaaaggcggcaaaatcactcgtgaagacgttgaagcattcttgaaaggtggttca
gcacctgcggcagcggcaacacctgcagcggcagcttctgaagctcctaaggctgctaaa
actgaagctaaagcaacatctgcagcagcgagcggtaatgttagtcttgaagaagaacgt
gtaccttacaagggcattcgtaaagcgatcgccaatgcaatggttaaatcggcttacact
gcacctcacgttacaattatggacgaagtagatgttactgaactggtagcattccgtaca
cgtatgaaaccaatcgctgagaaaaaaggcgttaaggttacttaccttccgttcattgtt
aaagcattggttgcagcttcccgtcaattcccagcgcttaacgctatgattgatgaagaa
gcaggcgagattgtttacaagaaatactacaacatcggtatcgctactgatacaccaaac
ggcttgatcgttccagttatcaaagatgctgaccgtaagagcatctggatgatcgctagc
agcatcactgaccttgcagttcgtggtcgtgacggtaaattgtctgctaacgaaatgaag
ggcagcacgatctccatcagtaacattggttctgctggcggtatgttctttactccaatc
attaacttccctgaagtggctatcctcggaactggccgtatcagtgaaaaagcagtagtt
aagaatggtgaaatcgtagttgctcctgtaatggcgttgtcactcagctttgaccaccgt
attatcgatggtgcgactgctcaaaactttatgaactacattaaatcgctgctcaataat
cctgagctgctggttatggaggtataa

DBGET integrated database retrieval system