KEGG   Paenibacillus sp. FSL H7-0737: H70737_25945Help
Entry
H70737_25945      CDS       T03359                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00010  Glycolysis / Gluconeogenesis
paej00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H70737_25945
   00500 Starch and sucrose metabolism
    H70737_25945
Enzymes [BR:paej01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     H70737_25945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIQ25987
UniProt: A0A089IRA0
LinkDB All DBs
Position
complement(5785827..5787239)
Genome map
AA seq 470 aa AA seqDB search
MELQFPKGFLWGGAVAANQLEGAYQEDGKGWSTQDVMPKGIKSAPTEVPTDDNMKLVGID
FYHRYKEDIKLFAEMGFKVFRTSIAWSRIFPKGDELEPNEKGLQFYDDLFDECHKYGIEP
LVTISHYETPLHLAREYDGWVNRKMVDFYERYVRTIYNRYKNKVKYWLTFNEINSILEFP
FMSGGINTPLEKLSKQDLYQAIHHEFVASALAVKIGHEINPDFQIGCMVLSMPIYPLTPH
PDDLIKAMQSDHKNMFFADVHARGYYPGYMKRFFKENGIHIHFEPGDEEILKHTVDFISF
SYYMSTCETADPEKQIRGEGNLLGGVPNPYLEASEWGWQIDPQGLRYVMNMFYDRYQKPL
FIVENGLGAVDQLVLDGNGEKVINDDYRINYLRDHLVQVAEAIADGVEVMGYTSWGCIDL
VSATSAELKKRYGFIYVDRHDDGSGTLERFRKKSFHWYKEVIESNGQNLF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggaattgcaatttccaaaaggattcttatggggcggtgctgtagcagccaatcagctt
gaaggggcgtatcaggaggatggtaaaggatggtccacccaagatgttatgccgaagggg
attaagtctgcgcctacagaggttcctaccgacgataatatgaagctggtgggaatcgat
ttctatcaccgatataaagaagatattaagctgttcgcggaaatgggctttaaagtgttt
cggacgtctattgcctggtcccggatttttccgaaaggggacgagctggagcccaatgaa
aaaggtctgcagttttacgacgacctattcgatgagtgtcataaatacggcatcgagcca
ctggtgactatctcccattatgaaactccgctgcatttggcaagagaatatgatggatgg
gttaaccgtaagatggtggatttttatgagcgctatgtgagaacgatatataatcgttac
aagaacaaggttaaatattggctgacctttaacgagattaactccattcttgagttccca
tttatgagtggcgggatcaatacgccgttagagaaattgagtaagcaggatctgtatcaa
gctattcatcatgagttcgtagcaagtgctctggctgtgaagatcggacatgagattaat
ccagacttccaaatcgggtgtatggtgcttagcatgccgatttatccgctcactccgcat
ccggacgatttgatcaaggcgatgcaaagtgatcacaaaaatatgttctttgcggatgtt
catgctagagggtattaccccggctatatgaagcggttcttcaaagaaaatgggattcac
attcattttgagccaggggacgaagagattctgaagcatacggtggatttcatatcgttc
agttactatatgagcacttgtgaaacggctgatccagagaaacagatcagaggagaaggg
aacctgctgggtggggtgcctaatccgtatctggaagcgagcgaatggggctggcagatc
gacccgcaaggcttgcgttatgttatgaatatgttctacgaccgatatcagaaaccgctg
tttatcgtggaaaatggtcttggcgctgtcgatcagctggtattagatgggaacggcgaa
aaggtaataaacgacgactatcggatcaattatttacgagatcatctggttcaggtcgcg
gaggctattgccgatggagtggaagtcatgggctatacaagctggggctgcatcgacttg
gttagcgcaacgagcgccgaactaaagaaacgttatggcttcatttatgtggaccgtcat
gacgatggctcgggcactcttgagagattccggaaaaagtccttccactggtacaaagaa
gtgattgaatccaacgggcagaacctgttctag

DBGET integrated database retrieval system