KEGG   Paenibacillus sp. FSL H7-0737: H70737_28995Help
Entry
H70737_28995      CDS       T03359                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
paej  Paenibacillus sp. FSL H7-0737
Pathway
paej00500  Starch and sucrose metabolism
paej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H70737_28995
Enzymes [BR:paej01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     H70737_28995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AIQ26519
UniProt: A0A089K0F8
LinkDB All DBs
Position
6461606..6463078
Genome map
AA seq 490 aa AA seqDB search
MMRNHTMMQFFEWHVAADGKHWDRLKETASALKAVGIDSVWVPPVTKAVSADDTGYGVYD
LYDLGEYDQKGTVRTKYGTKQALIEAISECQKNGIAVYVDLVMNHKAGADEKEVFQVIEV
DPNDRMKEISKPFEIEGWTKFTFPGRGDEHSSFKWNHNHFNGTDFDAKSGRTGVFRIAGE
NKTWNQNVDDEFGNYDYLMFANIDYSHPEVKKEMIQWGKWLVDTLHCSGFRLDAIKHINH
EFVKQFAVEMFNKCEKDFYIVGEFWNSDLESCRQFLNTVDYKIDLFDVSLHYKLHSASLG
GRNFDLTKILDDTLVQTHPTNAVTFVDNHDSQPHEALESWVDDWFKQSAYALILLRRDGY
PVVFYGDYYGIEGPTPVAGKKEAIDPLLYTRYHKAYGEQKDYFDHPNTIGWTRLGVKDIE
RSGCAVVISNGENGQKRMFVGEQRAGEAWVDFTHNHKATITIEKDGWATFPVNGGSVSVW
ALPDEKADEK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ataatgaggaaccatacaatgatgcaattttttgaatggcatgtcgctgcggatgggaaa
cactgggatcgcctgaaagaaacagcttccgcactaaaagccgtaggcattgattctgtt
tgggtacctcctgtgacaaaggccgtctccgccgacgatacaggctatggcgtgtatgat
ctatacgatctgggcgaatatgaccaaaaaggtacggtacgcaccaaatatggcaccaaa
caagcactgattgaagccatttcggaatgtcaaaaaaacggcattgccgtgtacgttgat
ttggtcatgaatcacaaagcaggagcggatgaaaaggaagtcttccaggtgatcgaggtc
gaccctaatgaccggatgaaagaaatctccaagcctttcgagattgagggctggactaaa
ttcaccttccccggccgcggtgatgaacactcttcctttaaatggaatcacaatcatttt
aacggcactgacttcgacgccaagtcggggcgaacaggtgtattccgtatcgcaggcgag
aataaaacatggaaccagaatgttgatgacgagttcggcaactacgattatctaatgttc
gcaaatattgattacagtcatccagaagtcaaaaaggaaatgatccaatggggaaaatgg
ctggtggacacgctccactgcagcggctttcgcttagatgccatcaagcatatcaaccat
gagtttgtgaaacaattcgcggtagaaatgtttaataaatgtgagaaggatttctatatc
gtgggtgagttctggaattcggatttagaatcctgccgacaatttctaaataccgtcgac
tataagatcgatctcttcgatgtctcccttcactacaagctgcattcagcttccttgggg
ggtagaaactttgatttaaccaaaatcctcgacgacacactggtgcagacccatcctacc
aatgctgtaacgttcgttgacaatcatgattctcaaccccatgaagctctggaatcttgg
gtagatgattggtttaagcaaagtgcttatgcacttatcctactgcgacgcgacggatat
cctgtggtcttttatggagattattatgggatcgagggacctacacctgtcgcaggcaaa
aaagaggcgattgacccgctgctatatacccgctatcacaaagcctatggtgagcagaag
gattatttcgatcatcccaacacgattggctggacacgactcggcgtgaaagacatcgaa
cgctccggctgtgcggttgtgattagtaacggtgagaacggtcagaaaagaatgttcgta
ggggaacaacgcgcgggtgaagcatgggtagatttcactcataatcacaaggcgactata
acgattgaaaaagatggctgggcgaccttcccggtcaacggtggcagcgtatctgtctgg
gctctgcctgatgaaaaagccgacgaaaaataa

DBGET integrated database retrieval system