KEGG   Paenisporosarcina sp. K2R23-3: D3873_06685Help
Entry
D3873_06685       CDS       T05647                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paek  Paenisporosarcina sp. K2R23-3
Brite
Enzymes [BR:paek01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D3873_06685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AYC29584
UniProt: A0A385YSS9
LinkDB All DBs
Position
complement(1326774..1327382)
Genome map
AA seq 202 aa AA seqDB search
MAYELPALPYAEDALEPHIDKETMNIHHTKHHNAYVTNLNNALEGHDDLLSKSVEELIAN
LDAVPESARTAVRNNGGGHANHSLFWQLLSPNGGGAPTGALAEAIDAKFGSFDSFKEEFA
KAGATRFGSGWAWLSVVNGELELSSTPNQDSPIMEGKTPILGLDVWEHAYYLNYQNRRPD
YIAAFWNVVNWDEVSKRYEAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaattaccagcactaccttatgcagaagatgcacttgaaccacacattgac
aaagaaacgatgaatattcaccacacaaaacatcataacgcgtatgtaacgaatttaaat
aatgcattagaaggtcatgatgatttgctttctaaatcagtagaagagctaattgctaat
cttgacgcagtgccagaatcagctcgcactgcagttcgcaataatggtggaggacatgct
aaccattcattattctggcaattactttcaccaaatggcggcggagctccaacgggtgct
ttagctgaagcaattgacgcgaaattcggtagctttgattcgtttaaagaagaattcgca
aaagctggagctacacgctttggttctggttgggcttggctatcagtagtgaatggtgag
ttagaactttcatctacaccaaaccaagattcaccaattatggaaggtaaaactccgatc
ttaggattagatgtttgggaacatgcatattacctaaactatcaaaaccgtcgtccagat
tatattgcagcattctggaatgttgtgaactgggatgaagtttcaaaacgttacgaagca
gcaaaataa

DBGET integrated database retrieval system