KEGG   Paenisporosarcina sp. K2R23-3: D3873_08825Help
Entry
D3873_08825       CDS       T05647                                 

Gene name
lipA
Definition
(GenBank) lipoyl synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
paek  Paenisporosarcina sp. K2R23-3
Pathway
paek00785  Lipoic acid metabolism
paek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paek00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    D3873_08825 (lipA)
Enzymes [BR:paek01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     D3873_08825 (lipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: AYC29971
UniProt: A0A385YU03
LinkDB All DBs
Position
complement(1725784..1726707)
Genome map
AA seq 307 aa AA seqDB search
MTTKQPPLRKPSWLKIKLNTNENYTGLKKMMRENNLHTVCEEARCPNIHECWGTRRTATF
MILGAVCTRACRFCAVKTGLPNELDLAEPERVADSVVMMNLKHAVVTAVARDDLKDGGSA
VFAETVRAIRRKNPFTTIEVLPSDMGGVEENLRALMDAKPDILNHNIETVRRLTPRVRAR
AKYDRSLEFLRRAKEMQPEIPTKSSLMVGLGETHEEIIEVMDDLRANHVDIMTIGQYLQP
TKKHLAVQKYYSPMEFGELRKIAMSKGFSHCEAGPLVRSSYHADEQVNAAAKEKQRLGDE
QLALSSN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaaacaaccaccacttcgaaaaccttcttggttaaaaataaaattgaatacg
aatgagaattacacgggtctgaagaaaatgatgcgtgagaataatttacatactgtgtgt
gaggaagcacgctgtccgaatatacatgaatgttggggtactcgtcgtactgctacgttt
atgattttaggggcagtttgtacccgtgcttgccgtttttgcgcggtgaaaacagggtta
ccgaatgagttagatttagcagaaccagaacgtgtagcggattctgttgtgatgatgaac
ttaaagcatgctgttgtaacagcagttgctcgagatgatttaaaagatggaggttctgct
gtatttgcggagacagttcgcgcgattcgtcggaaaaatccgttcacaaccattgaagtg
ttaccttctgatatgggtggcgtagaggaaaacctgcgtgcattgatggatgcaaaacca
gatattttaaatcataatatcgaaacagttcgtcgtttaacgccgagagttcgtgcgcgt
gcgaaatatgatcgttctctagagtttttaagaagagcgaaagaaatgcaacctgaaatt
cctacaaagtcttcgttgatggtaggtttgggtgaaacgcatgaggaaatcattgaagta
atggatgatttacgtgcaaaccacgttgacattatgacaattggtcaatacttacaacca
acaaaaaaacatcttgcggttcaaaaatattattcaccaatggaatttggagagcttcgt
aaaatagcgatgtctaaaggtttctctcattgtgaagctggcccgctagttcgaagcagt
tatcacgcagacgagcaagtaaatgctgcggcaaaagaaaaacaacgcttaggtgatgag
caattagctctttcttctaactag

DBGET integrated database retrieval system