KEGG   Paenisporosarcina sp. K2R23-3: D3873_08845Help
Entry
D3873_08845       CDS       T05647                                 

Gene name
yunB
Definition
(GenBank) sporulation protein YunB
Organism
paek  Paenisporosarcina sp. K2R23-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YunB NicO
Motif
Other DBs
NCBI-ProteinID: AYC29975
UniProt: A0A385YT02
LinkDB All DBs
Position
complement(1730930..1731694)
Genome map
AA seq 254 aa AA seqDB search
MFLFVRSRRSFKQPLKTRFAFLVVSFLLSVALLFVWINHRLTPTYLQYAEIQTSKIAAHV
ISKAINDRISNVLDVNDIIEHVPSEQSNMMTTKFNTEIINRVQSDTAKIVQTHLEQAEKG
NMDYLPYLTDVEYDQQSMEQDGGIVFFVPLGQAANLPLLGNIGPKVPIRFHVVGNVESKV
DSTIREFGINNAFVEVNIVLKVNVQIIVPMATSVKTLEQKIPVALGLIQGQVPQIFNRGD
GVQPSIEVPIQKNE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atttttttgtttgttcgatcaagaagaagttttaaacaacctctaaagactcgttttgcc
tttttagttgtttcatttctccttagtgttgccttgttgttcgtttggattaaccatcga
ttaacacctacttacttgcagtatgcggaaattcaaacatccaaaattgccgcacacgtg
attagtaaagctattaacgaccgaatttcgaatgtactagatgtgaacgatattattgaa
catgttccttctgaacaatcaaatatgatgactactaaatttaataccgaaattattaat
cgtgtgcagtcagataccgcaaaaatcgtacaaacccatttagaacaagcagaaaaaggg
aatatggattatttaccgtatttgaccgatgtagaatatgaccagcagtcgatggagcaa
gatgggggaattgtatttttcgttccccttgggcaagcggcaaacttacctttactaggg
aatatcgggccgaaagttcctattcgattccatgttgtcggaaacgtcgaatctaaagta
gattccaccatacgggaatttgggataaacaatgcatttgtagaggttaacattgtgttg
aaagtgaatgtgcagatcatcgttccgatggcaacttcagtgaaaacattagagcaaaaa
ataccagttgctctcggtctgattcaaggtcaagttcctcagattttcaaccgtggagat
ggtgtgcaaccatcgattgaagttcccatacaaaaaaacgagtaa

DBGET integrated database retrieval system