KEGG   Paenisporosarcina sp. K2R23-3: D3873_08865Help
Entry
D3873_08865       CDS       T05647                                 

Definition
(GenBank) DUF72 domain-containing protein
Organism
paek  Paenisporosarcina sp. K2R23-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF72 Patched
Motif
Other DBs
NCBI-ProteinID: AYC29979
UniProt: A0A385YT35
LinkDB All DBs
Position
complement(1735048..1735908)
Genome map
AA seq 286 aa AA seqDB search
MIHVGLTGWSDHPEVYSPSSKQNKLQDYSGNFPVVEVDTSFYAIPPKRNTYKWIEETPES
FQFVVKAYQGITGHHRGELPFANEEEMFHLFEESMMPFLEVGKLAMILLQFPPWFDCKKE
NVDRIRFLLERFEKFPVAIEFRHQSWYYPEYETKTLQFLEELGAIHSVCDEPQAGEGSIP
LVPIATSTEHVLVRLHGRNLHGWRNPGNEHNWREVRYLYDYNKEELQEISEMLQLLQKQA
ERVTVLFNNNSGGHAANNAKQLMKLMNIHYNNLAPKQLNLFEGDFF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgattcatgttggtttaactggttggagtgatcatccggaagtgtattcaccgtcttcg
aaacaaaacaaattgcaagattacagcggaaactttccagtggtagaagtggatacttct
ttttatgcgattcctccaaagcgaaatacatataaatggattgaagagacacccgaatcg
tttcagtttgtcgtgaaagcttaccaaggcattacgggtcatcatcgaggagaacttcct
tttgcgaatgaagaagagatgttccacttatttgaagagtcgatgatgccatttctggag
gtcggcaaacttgcgatgattttgttgcagtttccaccttggtttgattgcaaaaaagaa
aatgtcgatcgaattcggtttttactggaacgctttgagaagtttccagtagccatcgaa
ttccgccatcaatcttggtattacccagaatacgagacgaagacactgcaatttctggag
gaactaggtgccattcattctgtttgtgatgaaccacaggctggggaaggtagcattccg
cttgttccgattgctacatctactgaacatgtattagttcgtttgcacgggcggaatttg
cacggatggagaaatccgggaaatgagcacaattggagggaagttcggtatctttatgat
tataataaagaagagcttcaagaaatatcagaaatgctgcaactgcttcaaaagcaagca
gaacgtgtgaccgtgctgtttaacaataattctggcggccatgcagcgaataatgcgaag
caacttatgaagctcatgaacatacactacaacaatttagcgccaaagcagctgaattta
tttgaaggagattttttctaa

DBGET integrated database retrieval system