KEGG   Pseudomonas aeruginosa LES431: T223_04295Help
Entry
T223_04295        CDS       T02970                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
pael  Pseudomonas aeruginosa LES431
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AHC63522
LinkDB All DBs
Position
915766..916725
Genome map
AA seq 319 aa AA seqDB search
MPAHALLETRRASTQDIPLEQRLAFWEDYNASILVGLKCSSYSQAGFAATQDNLCLERLR
LARIGGNEHVVERDRSMIRAVPKESIFVSLVQGSQSFFYQDNGCNLLQPGELVIYRTDKP
YLFGFSGPMRQFIFDIPQDDFAERCLRDFKGPLKIGAESPVQRLLVRTLGERTRDFLDSP
HGEDAERYQEEAYDLLASIISDHAGEHRASALGASYLLAAKQYIQQHLDEPALSCERVAA
ATGVSSRHLARLFAQEGSSPGRYLQERRLERARQLLASPQGRRLDVAEVAYRHGFSSQAH
FARAFKARYGMTPSEARGR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacatgccttgctcgaaacccggcgggccagcacccaggacattcccctggag
cagcggctggcgttctgggaggactacaacgcttccatcctggttggcctgaaatgttcg
tcgtattcccaggccggcttcgccgcgacccaggacaacctctgcctcgaacgcctgcgg
ctggcccgcatcggcggcaacgagcacgtggtggagcgcgaccgctcgatgatccgcgca
gtgcccaaggagtcgatcttcgtctccctggtgcagggcagccagtcgttcttctaccag
gacaacggctgcaacctcctgcaaccgggcgagctggttatctaccggaccgacaagccc
tacctgttcggtttttccggaccgatgcggcagttcatcttcgacattccccaggacgat
ttcgccgagcgctgcctgcgcgacttcaagggaccgctgaagatcggcgcggaaagcccg
gtgcagcgcctgctggtgcggaccctcggcgagcgtacccgggatttcctcgacagcccc
catggcgaggatgccgagcgctaccaggaggaagcctacgacctgctggcgagcatcatc
agcgaccatgccggcgagcaccgtgccagcgccctgggcgcgtcctacctgctggcggcc
aagcagtacatccagcagcacctcgacgaacccgccctgagctgcgagcgggtggccgcc
gccactggcgtctccagccggcacctggcgcggctgttcgcccaggaaggcagctcgccc
gggcgctacctgcaggagcggcgcctggagcgggcccgccagttgctcgcctcgccccag
ggccggcgcctggatgtagccgaggtcgcctatcgccacggcttctccagccaggcgcat
ttcgcccgggccttcaaggcgcgctacgggatgacgccgagcgaggcgcgtggccgctag

DBGET integrated database retrieval system