KEGG   Pseudomonas aeruginosa LES431: T223_04300Help
Entry
T223_04300        CDS       T02970                                 

Definition
(GenBank) thioesterase
Organism
pael  Pseudomonas aeruginosa LES431
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3
Motif
Other DBs
NCBI-ProteinID: AHC63523
LinkDB All DBs
Position
916773..917189
Genome map
AA seq 138 aa AA seqDB search
MTDKKEQIARFIQREFPQTRVVVEAVGERSATVWQAVDASDLRPGGTVSGPTLMAIADVA
LYVAVLGEIGIVPLAVTTSLTINFLRRPAADRRVVAECRLMKVGKTLAMGEVSLFSEGDA
EPVAHVVGTYSIPPAHRR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaagaaagagcagatcgcccgtttcatccagcgcgaatttccccagacccgg
gtcgtggtcgaagccgtcggcgagcgtagcgccacggtctggcaggcggtcgacgccagc
gacctgcgccccggcggcacggtctccgggccgaccctgatggccatcgccgatgtcgcg
ctgtacgtggcggtactgggcgagatcggcatcgtcccgctggcggtgaccaccagcctg
accatcaacttcctgcggcgtccggcggcggaccgccgggtggtcgccgagtgccgcctg
atgaaggtcggcaagaccctggcgatgggcgaggtctcgctgttctccgaaggcgacgcg
gaaccggtcgcccatgtggtcggcacctactcgatcccgccggcgcaccgccgctga

DBGET integrated database retrieval system