KEGG   Pseudomonas aeruginosa LES431: T223_04305Help
Entry
T223_04305        CDS       T02970                                 

Definition
(GenBank) ferridoxin oxidoreductase subunit
Organism
pael  Pseudomonas aeruginosa LES431
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: AHC63524
LinkDB All DBs
Position
complement(917199..918311)
Genome map
AA seq 370 aa AA seqDB search
MSLPNANLIASSRKAAAQMATRDTSFIFNEWYVAAFAEEVGRELLARTLLGKRVVLYRTL
AGQAVALEDRCAHRSFPLSRSRLEGDGIVCGYHGFRYDSQGELIETPSQKACPRGVGIRH
YPLLERGPLVWIWLGDPRLADPKRLPQRPWLEDPGWACSKGYFLHPGNYVSMHENLMDLT
HLTYLHANTIGTPDYAGAPYELDLKEGHYRLVRHVLPTTLSPVWGRTTGLDGCPTAARIT
TSEFLSPGLHQVSATFYDTALPAERRPEFHIRTAHILTPETHGSMHYFIVHGRDFAQDDE
TVGAFMHEQLFAAFVEDVEGLGALEKVLAEADEDSYEISVASDAPAVATRTYLKRRADEE
ARQRAAHRVA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccaacgccaatctcatcgccagttcacgcaaggccgccgcgcagatggcc
acgcgcgacacgtcgttcatcttcaacgagtggtacgtcgccgccttcgccgaggaggtc
ggccgcgaactgctcgcgcgcactctgctcggcaagcgcgtggtgctctatcgcaccctc
gccggccaggcggtagccctggaagaccgctgcgcgcatcgctccttcccgctatcgcgc
agtcgcctggagggggacgggatcgtctgcggctatcacggtttccgctacgacagccag
ggcgagttgatcgagacaccgtcgcagaaagcctgtccgcgcggcgtcggcatccgtcac
tacccgcttctggagcgcggcccgctggtctggatttggctcggcgacccgcgactggcc
gacccgaagcgactgccgcagcggccctggctggaggatccgggctgggcctgctccaag
ggctacttcctacacccgggcaactacgtgagcatgcacgagaacctgatggacctgacc
catctcacctacctccacgccaataccatcggcaccccggattacgccggggcgccctat
gagctggacctgaaggaaggccactaccggctggtacggcacgtgctgccgaccaccctg
tcgccggtctggggccgcaccaccggcctcgacggctgtcccacggcggcgcgcatcacc
acctcggagtttctctcgccaggcctgcaccaggtcagcgcgaccttctacgacacagcc
ctgcccgccgagcggcgaccggaattccacatccgcacggcgcacatcctcaccccggag
acccacggcagcatgcactacttcatcgtccacggacgcgatttcgcccaggacgacgag
accgtcggcgctttcatgcacgagcaactgttcgccgccttcgtcgaggacgtggaaggc
ctcggagcgctggaaaaggtactcgcggaggccgatgaggatagctacgagatctccgtt
gccagcgacgcgccggcggtggccacccgcacctacctcaagcgccgcgccgatgaggaa
gcgcgccagcgcgcggcgcaccgggtggcctga

DBGET integrated database retrieval system