KEGG   Pseudomonas aeruginosa LES431: T223_06385Help
Entry
T223_06385        CDS       T02970                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00620  Pyruvate metabolism
pael00680  Methane metabolism
pael01100  Metabolic pathways
pael01120  Microbial metabolism in diverse environments
pael01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    T223_06385
  09102 Energy metabolism
   00680 Methane metabolism
    T223_06385
Enzymes [BR:pael01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     T223_06385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HAMP
Motif
Other DBs
NCBI-ProteinID: AHC63932
LinkDB All DBs
Position
1364977..1367613
Genome map
AA seq 878 aa AA seqDB search
MPEIDARLREDVHQLGELLGDTIREQYGPRFLDKIELIRKGAKAARRGSAEGAQQLTATL
DGLEEDELLPVARAFNQFLNLANIAEQYHRIRRRRPNEPEPFENLVLEELLGRLKDAGHA
PGQLARQLAGLEIELVLTAHPTEVARRTLIQKYDAITAQLAAKDHADLLPEERSRIQQRL
QRLVAEAWHTDEIRKVRPTPVDEAKWGFAVIEHSLWQALPNVLRHVDEVLLRSTGERLPL
TAAPLRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLYLRDIDRLAAELSMQQASPQ
LLARVGDNAEPYRALLKQLRERLRVTRNWTHQALAGEVPAAEGVLEHNRDLVEPLQLCHE
SLHACGMGVIADGALLDCLRRAATFGLFLVRLDVRQDSARHAAALSEITEYLELGSYDEW
DEKTRLEFLLEELNSRRPLLPAHYQPSADTAEVLATCRAIAAAPPASLGSYVISMAGQPS
DVLAVQLLLKESGVDWPMRVVPLFETLDDLDNAGPCMERLLTLPGYRSRLSGVQEVMIGY
SDSAKDAGTLTAAWAQYRAQEKLVEICRQHEVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRVTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLMPPPAPEPAWRAQMDRLA
KDALLAYRRVVRDDPQFVEYFRLATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT
QTRLMLPAWLGWETALLNAIERGEGALLGQMRERWPFFTTRIDMLEMVLAKADADIARLY
DERLVPLELRPLGRRLRDLLSQAVRVVLGLTGQSLLLAHASETRESISVRNSYLDPLHLL
QAELLARSRRCRGDACGGLEQALLVTVAGVAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatcgatgcgcgcctgcgcgaggacgtccaccaactgggcgaattgctcggc
gacaccatccgcgagcagtacggcccgcggttcctcgacaagatcgagctgatccgcaag
ggcgccaaggctgcccgccgcggttccgcggagggcgcccagcagctcaccgccaccctc
gacgggctcgaggaagacgaactgctgccggtggcgcgggccttcaaccagttcctcaac
ctggccaatatcgccgagcaataccaccgtatccgccggcgccggccgaacgagccggaa
cccttcgagaacctggtgctggaagagctgctggggcgtctcaaggacgccgggcatgcc
cccgggcaactggctcgccagctcgccgggctggagatcgaactggtgctgaccgcccat
cccaccgaggtggcgcggcgcacgctgatccagaaatacgatgcgatcaccgcgcagctg
gcggccaaggaccatgccgacctgctgccggaggagcgcagtcgcatccagcagcgcctg
cagcggctggtggccgaggcctggcataccgacgagatccgcaaggtccggccgaccccg
gtggacgaggcgaaatggggcttcgcggtgatcgaacattctctctggcaggccttgccg
aacgtccttcggcacgtcgacgaggtactcctgcgcagcaccggcgaacgcctgccgttg
accgccgcgccgctgcgcttcgcgtcctggatggggggcgaccgcgacggcaatcccaac
gtcaccgccagcgtgacccgcgaggtcctgctgctggcgcgctggatggccgccgacctg
tacctgcgcgatatcgaccgactggccgccgagctgtccatgcagcaggcctcgccgcag
ctgctggcgcgggtcggcgataacgctgagccctatcgcgccctgctcaagcaattgcgc
gagcgcctgcgcgtgacccgcaactggacccaccaggccctggccggcgaggtgccggcc
gcggagggcgtcctggagcacaaccgcgacctggtcgagccgctgcaactgtgccacgag
tcgctgcacgcctgcggcatgggcgtgatcgccgatggcgcgttgctcgactgcctgcgc
cgcgccgccaccttcggcctgttcctggtacgcctggacgtgcgccaggactcggcccgc
catgccgccgcgctgagcgagatcaccgagtacctggagctgggcagctacgacgagtgg
gacgagaagacccgcctggaattccttctcgaggaactgaacagccgccgccccctgctg
ccggcgcactaccagccttcggcggataccgccgaggtgctcgccacctgccgggcgatc
gccgccgcaccaccggcgtcgctggggtcctacgtgatctcgatggccggccagccgtcc
gacgtgctggcggtgcaactgctgctaaaggaaagcggcgtcgactggccgatgcgcgtg
gtgccgctgttcgagaccctcgacgacctggacaacgccggcccctgcatggagcgcctg
ctgacgctgccgggctaccgttcgcggctctccggggtgcaggaagtgatgatcggctac
tccgattcggccaaggacgccggtactctcacggcggcctgggcgcagtaccgggcgcag
gagaaactggtggagatctgccgccagcacgaggtcgagttgctgctcttccacggccgc
ggcggtaccgtcggtcgcggcggcgggccggcccacgcggcgatcctgtcgcagccgccg
ggttcggtggccgggcgcttccgggtcaccgaacagggcgagatgatccgcttcaagttc
ggtctgccggacatcgccgaacagaacctcaatctctacctcgccgcagtgctggaagcg
accctgatgccgccgccggctccggagccggcctggcgcgcgcagatggaccgcctggcg
aaggacgcgctgctggcctaccgcagggtggtgcgcgacgatccgcagttcgtcgagtat
ttccgcctggccacgcccgagcaggaactgggccgtctgccgctgggcagccgcccggcc
aagcgccgcgaaggcggggtggagagcctgcgggcgattccctggatcttcgcctggacc
cagacgcgcctgatgctgccggcatggcttggctgggagaccgccttgctgaacgccatc
gagcgtggcgagggcgcgctgctcgggcagatgcgcgagcgatggccgttcttcaccacc
cgcatcgacatgctggaaatggtcctggccaaggccgacgcggatatcgcgcggctctac
gacgaacgtctagtgccgctcgagctgcgtccgctggggcgtcgtttacgcgacctattg
tcgcaggcggtgcgcgtggtactgggactgaccgggcagtcgctgctgctcgcccacgcc
agcgagacccgcgagtcgatcagcgtgcgcaacagctatctagacccgctgcacctgctc
caggctgagcttctggcccgttcgcggcgctgccggggcgacgcctgcggcggcctggag
caggcgctgctggtgacggtcgcgggggtcgccgccggactgcgcaacaccggatga

DBGET integrated database retrieval system