KEGG   Pseudomonas aeruginosa LES431: T223_09385
Entry
T223_09385        CDS       T02970                                 

Definition
(GenBank) chromosome segregation protein ScpA
  KO
K05896  segregation and condensation protein A
Organism
pael  Pseudomonas aeruginosa LES431
Brite
KEGG Orthology (KO) [BR:pael00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pael03036]
    T223_09385
Chromosome and associated proteins [BR:pael03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    T223_09385
SSDB
Motif
Pfam: SMC_ScpA Imm19 Rad21_Rec8
Other DBs
NCBI-ProteinID: AHC64514
LinkDB
Position
1969348..1970172
AA seq 274 aa
MQLALVYGEAVTELPQDLYIPPDALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITR
QYMGYVELMKAVRLELAAEYLVMAAMLAEIKSRMLLPRSAEAEEEEEDPRAELIRRLQEY
ERFKKAAEDLDELPRVGRDVLVPAVAAPEARARKLLPELALQELMLVMGEMLRRADLFES
HQVTREVLSTRERMSEVLERLKGGAFVPFIQLFTLEEGKLGVVVTFMAILELVKEQMVEL
VQNEAFGAIHVRLRIAREAEEGETLEEALEDDFE
NT seq 825 nt   +upstreamnt  +downstreamnt
ctgcaactggcgctggtctacggcgaggcggtcaccgagctgccgcaggacctctatatc
ccgccggacgcgctggaggtcttcctcgaggccttcgagggcccgctcgacctgctgcta
tacctgatccgcaagcagaacatcgacatcctggatatcccggtggcggaaatcacccgc
cagtacatgggctatgtcgagctgatgaaggcggtgcgcctggagctggccgccgagtac
ctggtgatggcggcgatgctggcggagatcaagtcgcgcatgttgctgccgcgctcggcg
gaagccgaggaggaagaggaagatccacgggccgagctgatccgccgcctgcaggagtac
gaacggttcaagaaggccgccgaagacctcgacgaactgccccgggtcggccgcgacgtg
ctggtgccggcggtggctgctcccgaggcgcgggcgcgcaagctgctgccggagctggcg
ctgcaggagctgatgctggtgatgggcgagatgctgcgccgcgccgacctgttcgagagc
caccaggtgacccgcgaggtactgtccacccgcgaacgcatgagcgaagtgctggagcgc
ctgaaaggcggcgccttcgtgcccttcatccagttgttcaccctggaggagggcaagctc
ggcgtggtggtcaccttcatggcgatcctcgaactggtcaaggagcagatggtggaactg
gtgcagaacgaggctttcggcgccatccatgtgcgcctgcggatagcccgcgaagcggag
gaaggcgaaaccctggaggaagccctggaagacgatttcgagtga

DBGET integrated database retrieval system