KEGG   Pseudomonas aeruginosa LES431: T223_15525
Entry
T223_15525        CDS       T02970                                 

Definition
(GenBank) GMC family oxidoreductase
  KO
K06151  gluconate 2-dehydrogenase alpha chain [EC:1.1.99.3]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00030  Pentose phosphate pathway
pael01100  Metabolic pathways
pael01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    T223_15525
Enzymes [BR:pael01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.3  gluconate 2-dehydrogenase (acceptor)
     T223_15525
SSDB
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_3 DAO Pyr_redox_2
Other DBs
NCBI-ProteinID: AHC65685
LinkDB
Position
complement(3295802..3297577)
AA seq 591 aa
MATTLKPVDAVVVGFGWTGAILAKELTEAGLNVVALERGENRDTYPDGAYPNTLDELTYN
TRGKLFQNLSKSTVSIRHGINDTALPYRQLSAFLPGDGVGGAGLHWSGVHFRIMPEELRL
RSHYEERYGKKFIPEGMTIQDYGVSYEELEPHFDFAEKVFGTSGTAHTVKGQVVGKGNPF
AADRSDDFPLPALRQVYSAQLFRKAAEELGLHPYDLPAANASGPWTNPYGVQMGPCNFCG
FCSGYACYMYSKASPNLNILPALRQTPLFELRANCNVLKVNLDSDGRQATGVTYVDAQGR
EIVQPAKLVIISAFQFHNVRLLLLSGIGKPYDPRTGEGVVGKNFAYQNMATIKAFFDKDV
HTNPFVGTGGGGVAVDDFNADNFDHGPLGFVGGSPMWVNQAGSKPIGGLAVPPGTPSWGS
GWKQAVKDAYTHTVSMDAHGSNMTYRDNYLDLDPTYKDAYGQPLLRMTFDWKDNEIRMSR
YVTEHMRKIAEAMNPKAISVSVKNFGDHFNTRVYQTTHLLGGAIMGSDPKTSVLNRYLQS
WDVHNVFVMGASAFPQGTGYNPTGLVAALAYWSAKAIREQYLKDPGPLVQA
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggcgacgacactcaaaccggtggacgcggtggtggtcggcttcggctggaccggagcg
atcctggccaaggagctgaccgaggccgggctcaacgtggtggcgctggagcgcggcgag
aaccgcgatacctatcccgacggcgcctacccgaacaccctcgacgagctgacctacaac
acacgcggcaagctgttccagaatctctccaagagcaccgtgagcatccgccacgggatc
aacgacaccgcgctgccctaccgtcagctctccgccttccttcccggcgacggcgtcggt
ggcgccggcctgcactggtccggcgtgcatttccggatcatgcccgaggaactgcgcctg
cgcagccattacgaggaacgctacggcaagaaattcatccccgaaggcatgaccatccag
gactacggggtcagctacgaagagctggagccgcacttcgatttcgccgagaaggtcttc
ggcacctccggcaccgcgcatacggtcaagggccaggtggtcggcaagggcaatccgttc
gccgccgaccgctcggacgacttcccgctgccggcgctgcgccaggtgtactccgcgcaa
ctgttccgcaaggccgccgaggaactcggcctgcacccctacgacctgccggcggccaac
gcttcggggccctggaccaacccctacggggtgcagatggggccgtgcaacttctgcggc
ttctgcagcggctacgcctgctacatgtattccaaggcctcgccgaacctgaacatcctg
ccggcgctgcgccagaccccgctgttcgaactgcgcgccaactgcaacgtgctcaaggtc
aacctcgacagcgacggcaggcaggccaccggcgtgacctacgtcgacgcccaggggcgc
gagatcgtgcagccggcgaagctggtgatcatcagcgccttccagttccacaacgtgcgc
ctgctgctgctctccggcatcggcaagccctacgacccgcgcaccggcgagggcgtggtg
ggaaagaacttcgcctaccagaacatggccaccatcaaggcgttcttcgacaaggacgtg
cataccaaccccttcgtcggcaccggcggtggcggcgtggcggtggacgacttcaacgcc
gacaacttcgaccacggaccgctgggcttcgtcggcggctcgccgatgtgggtcaaccag
gccggctccaagccgatcggcggcctcgccgtgccgcccggcacgccgagctggggtagc
ggctggaaacaggcggtcaaggacgcctacacgcacaccgtgtcgatggacgcccacggc
agcaacatgacctaccgcgacaactacctcgacctcgacccgacctacaaggacgcctac
ggccagccactgctgcgcatgaccttcgactggaaggacaacgagatccgcatgagccgc
tacgtcaccgagcacatgcgcaagatcgccgaagcgatgaacccgaaggccatctcggtg
agcgtcaagaacttcggcgaccacttcaatacacgggtctaccagaccacccacctgctc
ggcggggcgatcatgggcagcgatccgaagaccagtgtgctcaaccgctacctgcagagc
tgggacgtgcacaacgtcttcgtcatgggcgcctcggccttcccccagggcaccggctac
aaccccactgggctggtggcggcgctggcctactggtcggccaaggcgatccgcgagcaa
tacctgaaggaccccggtccgctggtgcaggcatga

DBGET integrated database retrieval system