KEGG   Pseudomonas aeruginosa LES431: T223_17680Help
Entry
T223_17680        CDS       T02970                                 

Definition
(GenBank) nuclease
Organism
pael  Pseudomonas aeruginosa LES431
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VRR_NUC FANC_SAP
Motif
Other DBs
NCBI-ProteinID: AHC66106
LinkDB All DBs
Structure
PDB: 

Position
complement(3789563..3791212)
Genome map
AA seq 549 aa AA seqDB search
MNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEASQALLVRMVMRK
GTLFREGKLAYAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGR
ANLRKDALLERLQPLFPEARRLAEWQADFAEPVYELRCMALCDRLRLMYFGNLWQDWSEF
VLADLGIYRYESVEFSADSRGFRLRADVDAYLHLFDCRQRFDLGEPLEELLAGLPGEPYA
NPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLERGERFAEAHAL
AREASCAPESDAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWA
VREHLEEPGCAVHYVENGLINSLFGLLCWEAIFAAIPGAFFHPFHSAPADLHSADFRQRR
AALFEACLGRLEDGSYRDAIRCRYRDKFGLQSPFVYWELLGEELLEQALDCLPAAHLRAW
FERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAV
CYVRWHVDD
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccccagcgcttcccgaacccttctactacctgcacaacttccgcgcggtgctc
gcctggatcggcgaacgctatgccgatctgctcgacgatcaggaacgtgccttcatcgcc
gcgttcgccgagctgcccgaggccagccaggccctgctggtgcgcatggtgatgcgcaag
ggcacgctgttccgcgaaggcaagctggcctatgccgagatcggcgacacgcgcgccgcc
gtgcaaccgctgttggcattgggctgggtggacgcgcagccgaccctggaactggcgcaa
ctgttcggcttgctgaagaaggacgaattgtcgcagctgttcagggaccatctcgggcgc
gcgaacctgcgcaaggatgcgttgctggaacggctccagccgttgttccccgaggcgcgg
cggctcgccgagtggcaggccgacttcgccgaaccggtctacgagttgcgctgcatggcg
ctctgcgaccgcttgcggttgatgtatttcggcaacctgtggcaggactggtcggagttc
gtccttgccgacctgggtatctatcgttacgaaagcgtcgagttttccgccgactcccgc
ggctttcgcctgcgcgccgacgtcgacgcctatctccacctgttcgactgccgccagcgc
ttcgacctcggcgagccgctggaggaactgctcgccggcctgccgggcgaaccctacgcc
aatccctggctggaagggcggcgggtcaagctgctgttccagttcgcccagcactgcgaa
aagcagcgggatttcgacctggcccagcggctctatcgccaatccagccaccccggcgcg
cgcctgcgggcgattcgcagcctggaacgcggcgagcgcttcgccgaagcccatgcattg
gcgcgggaggccagctgtgcgccggaaagcgacgccgaacgccagggcctggcccgattg
ctgccgcgcctgcaaggcaagctcggcctgccgcgacaggcgcgggcggcggctccggaa
atcgaccgcctggacctgtgcctggcgttcccgagcgaaccctgtagcgtcgagtgggcg
gttcgcgagcacctggaagagcccggttgcgcggtgcactacgtcgagaacggcctgatc
aattcgctgttcgggctgctctgctgggaggcgatcttcgccgccattcccggggcgttc
ttccatcccttccacagcgcgccggcggacctgcacagcgccgacttccgccagcgccgc
gccgccctgttcgaggcctgcctgggacggctggaggacggcagctaccgcgacgcgatc
cgctgtcgctaccgcgacaagttcggcctgcagtcgcccttcgtctactgggaactgctt
ggcgaggaactgctcgaacaggcgctcgattgcctgccggcggcccacctgcgcgcctgg
ttcgaacgcctgctggaggatatcccgggcaaccgcgccggcctgccggacctgatccag
ttctggccggcgcagcggcgctaccggatggtcgaggtcaagggaccgggcgaccgcctg
caggacaaccagttgcgctggctgcaattctgccgcgagcgggagatgccggtggcggtc
tgctacgtgcgctggcatgtcgatgactga

DBGET integrated database retrieval system