KEGG   Pseudomonas aeruginosa LES431: T223_24460Help
Entry
T223_24460        CDS       T02970                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00473  D-Alanine metabolism
pael00550  Peptidoglycan biosynthesis
pael01100  Metabolic pathways
pael01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    T223_24460
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    T223_24460
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    T223_24460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pael01011]
    T223_24460
Enzymes [BR:pael01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     T223_24460
Peptidoglycan biosynthesis and degradation proteins [BR:pael01011]
 Precursor biosynthesis
  Amino acid ligase
   T223_24460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD RimK ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AHC67426
LinkDB All DBs
Position
complement(5223630..5224589)
Genome map
AA seq 319 aa AA seqDB search
MNLCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAARVDAFGIDVGE
DLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGVLASALAMDKLRTKRVW
LSLGLPTPDYAVLASEDDCREAAQRLGFPLIVKPAHEGSSIGMAKVGGLVELIAAWREAA
RYDSQVLVEQWISGPEFTVATLRGQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDE
AKESELKELTARACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAG
LDFQQLVLAILADSREARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttgcctcgatagcctgctgaacggcacccaggatcccaaggcgttcggccgc
gttgccgtgctgttcggcggcaagagcgccgagcgcgaggtgtcgctgaagtccggcgcg
atggtcctgcaatccctgctggccgccagggtcgatgccttcggcatcgatgtcggtgaa
gacctgctgcaacgcctggtcgaggagaagatcgaccgtgccttcatcattctccacggt
cgtggcggcgaggatggcagcatgcagggcctgctcgagtgcgcgggtattccctacacc
ggcagcggcgtgctggcctcggcgctggcgatggacaagctgcggaccaagcgggtctgg
ctcagcctcggcctgccgaccccggactacgcggtgctggccagcgaggatgactgccgt
gaagcggcgcagcgactgggtttcccgctgatcgtcaagccggctcacgaaggctcgagc
atcggcatggccaaggtcggcgggctcgtcgaattgatcgcggcgtggcgcgaagcggcc
cgctacgactcgcaggtgctggtcgagcagtggatcagcggcccggaattcaccgtggcg
accttgcgcgggcaggtgctgccggcgatccgcctgggcacgccgcacaccttctacgac
tacgacgccaagtacctggccagcgatacccgctaccaggtgccctgcggtctcgacgag
gccaaggaaagcgagctgaaggaactcaccgcgcgcgcctgcgacgccctgggcatccag
ggctgggggcgggcggacgtgatgcaggacgccgaagggcgtttctggctgcttgaagtc
aacaccgcaccgggcatgaccgaccacagcctggtgcctatggccgcgcgggccgccggc
ctggatttccagcaactggtgctggcgatcctggccgatagccgcgaggcgaggggataa

DBGET integrated database retrieval system