KEGG   Pseudomonas aeruginosa MTB-1: U769_00240Help
Entry
U769_00240        CDS       T02951                                 

Definition
(GenBank) hypothetical protein
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4010 MgtC Spore_YhaL
Motif
Other DBs
NCBI-ProteinID: AHB53293
LinkDB All DBs
Position
complement(63854..65107)
Genome map
AA seq 417 aa AA seqDB search
MTLSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLLGGFATLLAGE
LGSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSLALTEQRLLAAAG
GIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQGYGPWAFFNPYLTW
WMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLTLARLRERMPDALLACA
LLATSALMFPRILVEIGAIHPALLKELALPFAATTLVYLGGTLFHALRGGRASQEAPDEP
GLRNPFELLPALRFAALLSAILLLVEVGRRLFGDAGIYAVALLSGLADVDAITLSLARAA
QGELDPGVASRGIALAALSNSLVKAGLIVLVGGKRLALQTLHFSLAGLLVGALLILL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgctttccctggatctgttgttgagcctgtgcacggccctggccatcggcctcctg
atcggcgccgagcgcggctggcaggagcgcgaccacgaagatgcacggcagatcgccgga
atccgcaccttcagcctggccggcctgctcggcggcttcgccaccctgctcgcgggcgaa
ctgggcagcgcagtctgggtagccttgctgctggccctcgcggcgctggccgtggccggc
tacgtgagcgacgtcaggcgtggcggcgaccagggcatgaccaccgagatcgccctactg
atgaccttcctcctcggcagcctcgccctcaccgaacagcgcctgctggctgccgccggc
ggcatcgtgctgaccctgctgctgagcctcaaggacaagctccacgccctgctgaagcgc
ctgaccgccgaggaactgtcgggcaccctcaagctgctgttcatctccgtggtcctgctg
ccggtgctgcccaaccagggctacggtccctgggcgttcttcaatccctacctgacttgg
tggatggtggtgctgatcgccgccctcggtttctccgcctacctggccatccgcctgatc
ggctcgcgcaagggcctgttgctgaccgcggtgctcggcggcttggtgtcctccacggtg
atgaccctgaccctggcgcgcctgcgcgagcgcatgcccgacgccctgttggcgtgcgcc
ctgctggcgacctcggcgctgatgttcccgcgcatcctcgtcgagatcggcgcgatccac
ccggccttgctgaaggagctggccctgccattcgccgccaccaccctcgtctaccttggc
ggcacgctgttccacgccctgcgcggcggccgcgccagccaggaggcacccgacgagcca
ggcctgcgcaaccccttcgaactgctcccggccctgcgtttcgccgccctgctgagcgcg
atcctgctgttggtggaggtcggccggcggctgttcggcgatgccggcatctacgcggtc
gcactgctctccggcctcgccgacgtcgacgcgatcaccctgtccctggcccgcgcggcg
cagggcgaactcgatccaggcgtggccagccgcggcatcgcccttgccgccctgagcaac
agcctggtcaaggccggcctgatcgtgctggtgggcggcaagcggctggccctgcaaacg
ctgcacttcagcctggcggggctgctggtaggagcgctgctgatcctgttgtga

DBGET integrated database retrieval system