KEGG   Pseudomonas aeruginosa MTB-1: U769_01425Help
Entry
U769_01425        CDS       T02951                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    U769_01425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHB53533
LinkDB All DBs
Position
complement(312452..313204)
Genome map
AA seq 250 aa AA seqDB search
MSVDLHALIPLIALTFLLAGFVKGVVGLGLPTVSVGLLGLAMPPMQAAALLIVPSMVTNL
WQLACGPRFLGLMKRLAGLLLGVVVGTLLVGAWLGGDAPRQATGVLGLALVAYALLGLAA
IPLHLPARHEPWAGPLVGLATGALTAVTGVFVIPAVPYLGALGLQRDELVQALGLSFSAS
TLALAVTLGVHGDLLEPQMLGASLLTLVPALGGMLLGQWLRQRISAALFRRCFFVGLLLL
GADLAWRGFH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgacctccacgccctgatcccgctgatcgccctcaccttccttctcgccggc
ttcgtcaagggcgtggtcggcctgggcctgccgacggtctcggtgggtctgctcggcctg
gccatgccgccgatgcaggcggcggcgctgctgatcgtaccgtcgatggtgaccaacctc
tggcagctcgcctgcggcccgcgcttcctcggcttgatgaagcgcctggccggcctgctg
ctcggggtggtcgtgggcaccctgctggtcggcgcatggctcggcggcgacgcaccaagg
caggccaccggcgtgctcggcctggccctggtggcctacgcgctgctcggcctggccgcg
atcccgctgcacctgccggcacgccacgagccctgggccggtccgctggtcgggctggcg
accggcgcgctgaccgcagtcaccggggttttcgtgattcccgcggtgccctacctggga
gccctaggattgcagcgcgacgaactggtccaggccctcggcctgtcgttcagcgcctcg
accctggccctggcggtcactctcggcgtgcatggcgacctgctcgaaccgcagatgctc
ggtgcctcgctgctgaccctggtcccggcgctgggcgggatgctcctcggccagtggctg
cgccagcggatcagcgcggcgctgttcaggcgctgcttcttcgtcggtctcctgctgctc
ggcgccgacctcgcctggcgcggtttccactga

DBGET integrated database retrieval system