KEGG   Pseudomonas aeruginosa MTB-1: U769_03790Help
Entry
U769_03790        CDS       T02951                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paem01100  Metabolic pathways
paem01110  Biosynthesis of secondary metabolites
paem01130  Biosynthesis of antibiotics
paem01230  Biosynthesis of amino acids
paem02024  Quorum sensing
Module
paem_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:paem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    U769_03790
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    U769_03790
Enzymes [BR:paem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     U769_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: AHB53999
LinkDB All DBs
Structure
PDB: 

Position
complement(795756..796973)
Genome map
AA seq 405 aa AA seqDB search
MDDLLQRVRRCEALQQPEWGDPSRLRDVQAYLRGSPALIRAGDILALRATLARVARGEAL
VVQCGDCAEDMDDHHAENVARKAAVLELLAGALRLAGRRPVIRVGRIAGQYAKPRSKPHE
QVGEQTLPVYRGDMVNGREAHAEQRRADPQRILKGYAAARNIMRHLGWDAASGQEANASP
VWTSHEMLLLDYELSMLREDEQRRVYLGSTHWPWIGERTRQVDGAHVALLAEVLNPVACK
VGPEIGRDQLLALCERLDPRREPGRLTLIARMGAQKVGERLPPLVEAVRAAGHPVIWLSD
PMHGNTIVAPCGNKTRLVRSIAEEVAAFRLAVSGSGGVAAGLHLETTPDDVTECVADSSG
LHQVSRHYTSLCDPRLNPWQALSAVMAWSGAEAIPSATFPLETVA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacgatctattgcaacgcgtacggcgctgcgaagcgctgcagcaacccgaatggggc
gatccgtcgcgcctgcgcgacgtgcaggcgtacctgcgcggcagtccggcgctgatccgc
gccggcgacatcctggccctgcgcgcgaccctggcgcgggtcgcccgcggcgaggcgctg
gtggtgcagtgcggcgactgcgccgaggacatggacgaccaccatgccgagaacgtggcg
cgcaaggccgccgtgctggaactgctggccggcgccctgcgcctggccggccggcggccg
gtgatccgcgtcgggcgcatcgccgggcagtacgccaagccgcgttccaagccgcacgag
caggtcggcgagcagaccctgccggtctatcgcggcgacatggtcaacggccgcgaggcc
catgccgagcagcgccgggccgatccgcagcggattctcaagggctatgcggcggcgcgc
aacatcatgcgccacctgggctgggacgccgcgtccgggcaggaggcgaatgcctcaccg
gtctggaccagccacgagatgctgctgctcgactacgagctgtcgatgctgcgcgaggac
gagcagcgccgggtctatctcggttcgacccactggccgtggatcggcgagcgcacccgc
caggtcgacggcgcccatgtggcgctgctggccgaggtgctcaacccggtggcctgcaag
gtcggtccggagatcggccgcgaccagttgctggcgctctgcgagcgcctcgatccgcgc
cgcgagccgggacgcctgacgctgatcgcgcggatgggcgcgcagaaggtcggcgagcgc
ctgccgccgctggtggaagcggtgcgcgcggccggccacccggtgatctggctgagcgac
ccgatgcacggcaacaccatcgtcgcgccctgcggcaacaagacccgcctggtgcgcagc
atcgccgaggaggtggcggcgttccgcctggcggtgtccggctccggcggcgtggccgcc
gggctgcacctggagaccaccccggacgacgtcaccgagtgcgtcgccgattccagcggc
ctgcaccaggtcagccggcactacaccagcctctgcgatccgcggctgaacccctggcag
gcgctcagcgcggtgatggcctggtccggcgcagaagcgatcccgagcgcaaccttcccc
ctggagaccgtggcatga

DBGET integrated database retrieval system