KEGG   Pseudomonas aeruginosa MTB-1: U769_04165Help
Entry
U769_04165        CDS       T02951                                 

Definition
(GenBank) MFS transporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paem02000]
    U769_04165
Transporters [BR:paem02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    U769_04165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12 MFS_2 MFS_1_like BT1
Motif
Other DBs
NCBI-ProteinID: AHB54074
LinkDB All DBs
Position
887237..888445
Genome map
AA seq 402 aa AA seqDB search
MPASASRIQLGSGERRLLLLLSALVAFGPLSIDMYLPSLPAIAADLGASDAQVQRSISGF
LVGFCVGMLFYGPLSDRFGRRPVLLAGIALYLFSSLACALADSAGQLVLLRVLQALGGGA
ASVLARAMVRDLYPLGEAARMLALMHMVTMLAPLAAPLLGGYLMLWAGWRALFVVLALFA
GLCLLAVWRVAESHPPERRGGSLAQAFLAYGRLLGDRRALGYVLCMGLAFAGMFAYISAA
PFVFIEHFGVRAERFGWFFGLNILGVMLATWCSARLVRRHGPRPLLRAGSLLACVSGLFL
LGYAALGERGGLWALVPGLLCFVSVTGLLGANCIASLLALYPGQAGAASAVAVSGQFGLG
CLASLAVGWLALPGVLPMALVMAVCGVGSLLALGLALYGGDR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcgagtgcatcgaggattcagctcggaagcggcgaacgacgcctgttgctgctg
ttgtcggcgctggtggcgttcggcccgctgtcgatcgacatgtatttgccgagcctgccg
gcgatcgccgccgatctcggcgccagcgatgcccaggtgcagcggagcatcagcggcttc
ctggtcggcttctgcgtcggcatgctgttctacggccccttgtccgaccgtttcggccgg
cgcccggtgctgctggccggtattgccttgtacctgttcagcagcctggcctgcgcgctg
gccgacagcgcggggcaactggtcctgctgagggtgctccaggccctcggcggcggcgcc
gcgtcggtgctggcgcgggccatggtgcgcgacctctatccgttgggcgaggccgcccgg
atgctggcattgatgcacatggtgaccatgctggcaccgctggccgcgccgctgctcggc
ggctacctgatgctctgggccggctggcgcgcgttgttcgtggtcctggcgctgttcgcc
gggctctgcctgctggcggtctggcgggtcgccgaaagccacccgccggagcgccgcggc
ggcagcctggcccaggcctttctcgcctatgggcggctgctcggcgaccgtcgcgcgctg
ggctacgtgctgtgcatggggctggcgttcgccgggatgttcgcctacatcagcgccgcg
cccttcgtgttcatcgagcatttcggcgtgcgcgcggagcgcttcggctggttcttcggc
ctgaacatcctcggcgtgatgctcgccacctggtgcagcgcgcgcctggtgcgccgccac
ggtccgcggccgctgctgcgggccggcagcctgctggcctgcgtgtccgggctgttcctc
ctcggctatgcggcgctcggcgagcggggcgggttgtgggcgctggtgcccgggctgctg
tgcttcgtcagcgtcaccggcctgctcggcgccaactgcatcgccagcctgctggcgttg
tatcccggtcaggccggggcggcttcggcggtggcggtatccgggcagttcggcctcggt
tgcctggccagcctggcggtcggctggctggcgttgcccggcgtgctgccgatggcgctg
gtgatggccgtctgcggcgtcggcagcctgctcgcgctgggcttggccctgtacggcgga
gaccgctga

DBGET integrated database retrieval system