KEGG   Pseudomonas aeruginosa MTB-1: U769_05170Help
Entry
U769_05170        CDS       T02951                                 

Definition
(GenBank) peptide transporter
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OPT FHIPEP
Motif
Other DBs
NCBI-ProteinID: AHB54274
LinkDB All DBs
Position
1097417..1099453
Genome map
AA seq 678 aa AA seqDB search
MQERIPDELTLPELTLRGLILGALITVVFTASNVYLGLKVGLTFASSIPAAVISMAVLRY
FSGANILENNMVQTQASAAGTLSSIIFILPGLLMIGYWSGFPFWQTAAICSIGGILGVLY
TIPLRRVMVVQSELPYPEGVAAAEILRVGSDGAEDEEDARAPRAAGNAPGLYDILGGGLV
AALFSLWSSGFKVLAEGFSVWLSAGQAAFRLSTGFSLALVGAGYLMGITAGIAILIGVVI
SWGVAVPLLTVNSVPADGQSLSDLATQLWSSQVRFLGAGTIGVAALWTLATLFKPMVRGV
WASLGAVRGNSQANSLRTELDMPAKWILLIAGILLVSLFVVFSHFLGAAAPDMAGPQFWS
LVAVCVVFAFFFGFLIAAACGYMAGLVGSSSSPISGIGIIAVILVSLLILGFGSIEGGLL
DRQNGKLAIALALFTTSVVLAIAAISNDNLQDLKTGYLVGATPWRQQVALIVGCIVGALV
IPPVLELLYSAYGFTGALPREGMDPGQALAAPQATLMTAIASGIFHDALNWNMILIGVAL
GIALILVDLLLRRTGKACLPVLAVGLGIYLPPTIGMTLVVGALISWLLENALKKRAAAAG
VDEETYAEEPKRRGVLLASGLIVGESLMGILLAGVIGATGEDAPLALAGAGFAGIAQWLG
LVVFVAICVLFYRRVLAR
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacgcatcccggatgagctgaccctgccagagctcaccctgcgtggcctgatc
ctcggtgcgctgatcaccgtggtcttcaccgcctccaacgtctacctcggtctgaaggtc
ggcctgaccttcgcctcgtcgatcccggcggcggtgatctcgatggccgtcctgcgctac
ttctccggcgccaacatcctcgagaacaacatggtgcagacccaggcctcggcggccggc
accctgtcctcgatcatcttcatccttcccggcctgctgatgatcggctactggagtggc
ttcccgttctggcagaccgcggcgatctgctccatcggcggcattctcggggtgctctat
accattccgctgcgccgggtgatggtggtgcagagcgaactgccgtatccggaaggggtg
gcggcggcggaaatcctccgggtcggcagcgacggcgccgaggacgaggaagacgcccgc
gcgccgcgtgccgccggtaacgcgccggggctctacgacatcctcggcggcggcctggtg
gcggcgctgttcagcctctggagcagcggcttcaaggttctcgccgaaggcttcagcgtc
tggctcagtgccgggcaggcggcgttccgcctttccaccggtttttccctggcgctggtc
ggtgccggctacctgatgggcatcaccgccggcatcgcgatcctcatcggcgtggtgatc
tcctggggcgtcgcggtgccgttgctgaccgtcaacagcgtgccggccgacggccagagc
ctgtcggacctggccacccaactgtggagttcgcaggtgcgcttcctcggcgccggcacc
atcggcgtggccgcgctgtggaccctggcgaccctgttcaagccgatggtgcggggcgtc
tgggcctccctcggggcagtgcgcggcaatagccaggcgaacagcctgcgcaccgagctg
gacatgccggccaagtggatcctgctgatcgccgggatactgctggtctcgctgttcgtg
gtcttcagccacttcctcggtgccgccgcgccggacatggccggcccgcagttctggagc
ctggtggcggtatgcgtggtgttcgccttcttcttcggcttcctgatcgccgccgcctgc
ggctacatggccggcctggtcggttcgtcgagcagtccgatctcggggatcggaatcatc
gcggtcatcctggtgtcgttgctgatactcggcttcggcagcatcgagggcggcctgctg
gaccgccagaacggcaagctggcgatcgccctggcgctgtttaccacctcggtggtgctg
gccatcgcggcgatctccaacgacaacctgcaggacctcaagaccggctacctggtcggc
gccacgccctggcgccagcaggtcgcgctgatcgtcggctgcatcgtcggcgcgctggtg
atccccccggtgctggaactgctctacagcgcctacggcttcaccggggccctgccgcgc
gagggaatggaccccggccaggccctggccgcgccgcaggcgaccctgatgacggcgatc
gccagcgggattttccacgacgcgctgaactggaacatgattctcatcggcgtcgccctg
ggcatcgccctgatcctcgtcgacctgctcctgcgccgtaccggcaaggcctgcctgccg
gtgctggcggtgggcctggggatctacctgccgccgaccatcggcatgaccctggtggtc
ggcgcgctgatttcctggctgctggaaaatgccctgaagaagcgcgcggcggcagccggg
gtcgacgaagagacctatgccgaagagccgaagcgacgcggcgtgctgctggcctcgggg
ctgatcgtcggcgagagcctgatgggcatcctgctcgccggggtgatcggcgccaccggc
gaggacgcgccgctggcgctggccggcgccggcttcgcgggcatcgcccaatggctggga
ctggtggtattcgtcgcgatctgcgtgctgttctaccggcgagtgctggcgcgctga

DBGET integrated database retrieval system