KEGG   Pseudomonas aeruginosa MTB-1: U769_05800
Entry
U769_05800        CDS       T02951                                 

Definition
(GenBank) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00730  Thiamine metabolism
paem01100  Metabolic pathways
paem04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:paem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    U769_05800
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    U769_05800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paem03016]
    U769_05800
   03029 Mitochondrial biogenesis [BR:paem03029]
    U769_05800
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:paem02048]
    U769_05800
Enzymes [BR:paem01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     U769_05800
Transfer RNA biogenesis [BR:paem03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    U769_05800
 Prokaryotic type
    U769_05800
Mitochondrial biogenesis [BR:paem03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    U769_05800
Prokaryotic defense system [BR:paem02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   U769_05800
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-ProteinID: AHB54400
LinkDB
Position
1238405..1239619
AA seq 404 aa
MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKAEEAVENARRQVAE
LVNADPREIVWTSGATESDNLAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFE
VTYLEPGEDGLITPALVEAALRDDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLFHVD
AAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMR
SGTLATHQIVGMGEAFRIAKEEMAQENARVLALRDRFFAQIDGLEELYINGSMTSRVPHN
LNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRF
TTEEEIDYAAKKVVEAVSKLRELSPLWDMYKEGVDLSQVEWQAH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgaaattgccgatctacctcgattactccgcgaccactcccgtcgatccccgcgtcgcc
cagaaaatgagcgaatgcctgctgatggacggcaacttcggcaacccggcttcgcgttcc
cacgtgttcggctggaaagccgaggaggccgtggagaacgcccgtcgccaggtggccgaa
ctggtcaacgccgatccccgcgagatcgtctggacctccggcgccaccgagtccgacaac
ctggcgatcaagggcgtcgcgcacttctactcgggcaagggcaagcacatcatcacctcg
aagatcgagcacaaggcggtcctcgacacctgccgccagctggagcgcgaaggtttcgaa
gtgacctacctggagccgggcgaagatggcctgatcactccggctctggtcgaggcggcg
ctgcgtgacgacaccatcctggtctcggtcatgcacgtgaacaacgagatcggcaccgtc
aacgacatcgccgccatcggcgagctgacccgctcccgcggcgtgctgttccacgtcgac
gccgcacagtcgaccggcaaggtcgagatcgacctggacaagctcaaggtcgacctgatg
tccttctccgcgcacaagacctacggcccgaaaggcattggcgcgctctacgtccggcgc
aagccgcgcgtccgcatcgagggccagatgcacggcggcggccatgagcgcggcatgcgt
tccggcaccctggccacccaccagatcgtcggcatgggcgaggcgttccgcatcgccaag
gaagaaatggcccaggagaacgcccgcgtgctggcgctccgcgaccgcttcttcgcgcag
atcgacggcctggaagagctctacatcaacggcagcatgacctcccgcgtcccgcacaac
ctcaacgtcagcttcaactacgtcgagggcgagtcgctgatcatggcgctcaaggacctc
gcggtctcctccggttcggcctgtacctcggcgtccctggaaccgtcctacgtattgcgc
gccctgggccgcaacgacgaactggcgcatagctccatccgcttcaccttcggtcgcttc
accaccgaggaagagatcgactatgccgcgaagaaggtggtcgaggccgtttccaagctg
cgcgaactgtcgccgctgtgggatatgtacaaagagggcgtcgacctgtcccaggtcgaa
tggcaggcgcactga

DBGET integrated database retrieval system