KEGG   Pseudomonas aeruginosa MTB-1: U769_06010Help
Entry
U769_06010        CDS       T02951                                 

Definition
(GenBank) MFS transporter
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AHB54442
LinkDB All DBs
Position
complement(1278308..1279465)
Genome map
AA seq 385 aa AA seqDB search
MNASDKTLASASPASGNLALLAAIVVFAAITPTILMTAPAVAAQLAAQWQLSPARVGDLF
SVELGAMSLATLPAFHWLKRVDWRHAALLAGLLFIAANLASALAGSYPLLLALRFCSALA
GGSLMILCLSSAASTATPSRVYGLWVMGQLVVGAVGLALLPALFERFGLAACYLLLAGLM
GLALPLSRAFPSGSPPAEARASTGAVHSRLRVALGILAVLTFYISLSGVWTFIGAIAEGA
GIGAGASGEVLAVATLMGIAGAACASFIGNRLPRDLMLLGGYLAMAAAILLLIGQPPLAR
FALAALLFKFTWTFALPFILACLADLDRSGRLMNASNLVIGGGLAIGPALAGRLIEGSGG
FLPLLPIAAGLAGLSLLLALACRPR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttccgacaagactctcgccagcgcctctccggcgtccggcaacctcgcgctg
ctcgcggccatcgtggtgttcgccgcgatcaccccgaccatcctgatgaccgcccccgcc
gtcgccgcgcaactggcggcccagtggcaactgagcccggcgcgggtcggcgacctgttt
tcggtggagctaggcgccatgagcctggcgacgctgccggctttccattggctgaaacgc
gtcgattggcgccacgcggcgctgctcgccggcctgctgttcatcgccgccaacctggcc
tcggcgctggccggcagctacccgctgctgctcgccctgcgtttctgcagcgccctcgcc
ggcggctcgctgatgatcctctgcctgtccagcgccgccagcaccgccaccccgagccgg
gtctacgggctctgggtgatgggccaactggtggtcggcgccgtcggcctggcgctgctg
ccggcgctgttcgaacgcttcggcctggccgcctgctacctgttgctggccggcctgatg
ggcctcgccctgccgttgtcgcgggccttccccagtggcagcccaccggcggaagcccgc
gccagtaccggcgcggttcactcgcgactgcgggtcgcactgggcatcctcgccgtgctc
accttctatatcagcctcagcggtgtctggaccttcatcggcgccatcgccgaaggcgcg
gggatcggtgccggcgccagcggcgaggtactcgccgtcgccaccctgatgggcatcgcc
ggggcggcctgcgcctccttcatcggcaaccgcctgccgcgcgacctgatgctgctcggc
ggctacctggcgatggccgcggcgatcctcctgctgatcggccagccgccgctggcgcgc
ttcgccctggccgcgctgctgttcaagttcacctggaccttcgccctgccgttcatcctc
gcctgcctcgccgacctggaccgctccggccgcctgatgaacgcctccaacctggtcatc
ggcggcgggctggccatcggcccggcgctggccggacgactcatcgaaggcagcggcggt
ttcctcccgctgctgccgatcgccgccggcctggccggcctctcgctgctgctggccctg
gcctgccggccacgctga

DBGET integrated database retrieval system