KEGG   Pseudomonas aeruginosa MTB-1: U769_08345Help
Entry
U769_08345        CDS       T02951                                 

Definition
(GenBank) MFS transporter
  KO
K18567  MFS transporter, DHA1 family, purine base/nucleoside efflux pump
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paem02000]
    U769_08345
Transporters [BR:paem02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    U769_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Motif
Other DBs
NCBI-ProteinID: AHB54909
LinkDB All DBs
Position
complement(1787730..1788905)
Genome map
AA seq 391 aa AA seqDB search
MDLRLLLLSLTTFAAGLAESILIGILPPLAEDLRVSISLAGQLTTLFSLGFALAAPLLGW
LTRRIERRRLLLATLLLFALSNALAALAPGYLGLLLARLGMSACCGLLIVLASLLAAELA
APAQRGRAIGLIFMGISGSLVFGVPLGVQISDWFGWRWIFAGIAVYSLPLCLLLWRYLPQ
RQAGDLPGREGYLRQLRQPALWLAQLVSILLLGGHFTLFAYFTPYLASMAGIRSPGEISL
ILLLIGLAALSGGYIGGWLADRLGHRRALRLVPAAFALALAAVPLSLGSIGFLPVLMVWS
AISWMISPVVQSFLLRSDPASGSAGVALNTSAMHLGVGLGAALGGLVVAALGVAATPWVG
LALVLAALACALGASTLDGATQALPLSPPAR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaccttcgcttgctgttgctatccctgaccaccttcgccgccggcctggcggaaagc
atcctgatcggcatcctgccgcccctggccgaagacctgcgggtctccatcagcctggcc
ggccagctcaccaccctgttctccctcggcttcgccctcgccgcaccgctgctcggctgg
ctgacccggcgcatcgaacgccgccgcctgctgctggcgaccctgctgctgttcgccctc
agcaacgcgctcgccgccctcgctccgggctatctcggcctgctcctggctcgcctggga
atgtcggcctgttgcgggctgctgatcgtcctcgccagcctgctcgccgccgagctggcc
gccccggcccagcgcggccgggcgatcggcctgatcttcatgggcatcagcggttcgctg
gtgttcggcgtgccactgggcgtacagatcagcgactggttcggctggcgctggatcttc
gccggcatcgcagtctattcgctgcccttgtgcctgctgctctggcgctacctgccgcaa
cgccaggccggcgacctgcccggccgcgaaggctacctgcggcagttgcgccagcccgcg
ctgtggctcgcgcaactggtatcgatcctgttgctcggcgggcacttcaccctgttcgcc
tatttcaccccgtacctggcgagcatggccggtattcgctcgcccggcgagatcagcctg
atcctcctgctgatcggcctggcagcgctgagcggcggctatatcggcggctggctggcc
gaccgcctcggccaccggcgcgccctgcgtctggtgccggcggccttcgccctggcgctg
gcggcggtgccgctgagcctgggcagcatcgggttcctgccggtactgatggtctggagc
gcgatcagctggatgatctcgccggtggtgcagagcttcctgctgcgcagcgatccggcc
agcggttccgccggcgtcgccctgaacacctcggccatgcacctgggcgtgggcctcggc
gcggcgctgggcggcctggtggtggcggcactgggagtcgccgcgacgccctgggtcggc
ctcgccctggtgctggcggcgctggcctgcgcgcttggcgccagcacgctggatggcgcc
actcaagcgctgccgctcagtccccctgcacggtga

DBGET integrated database retrieval system