KEGG   Pseudomonas aeruginosa MTB-1: U769_08420
Entry
U769_08420        CDS       T02951                                 

Definition
(GenBank) ankyrin
  KO
K06867  uncharacterized protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    U769_08420
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-ProteinID: AHB54926
LinkDB
Position
complement(1809297..1809812)
AA seq 171 aa
MTDSPRPELDMETQEFVHQLFDLARQGNSQRLEQLLQQGLPPNLRNHKGDSLLMLASYHG
HADTVRLLLAYKADPDLRNLAGQTPLAGAAFKGDLAMVELLLAGGADVEGASADGKTALM
MAAMFNQAEVASSLLAHGARRDAQDAAGLTPLAAARMMNAEATVALLSRPH
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaccgatagccctcgcccagaactggatatggaaacccaggagttcgtccaccagctg
ttcgacctggcccgccagggcaacagccagcgcctcgagcaactgctgcaacagggcctg
ccgccgaacctgcgcaaccacaagggcgatagcctgctgatgctggccagctaccatggc
cacgccgacacggtacgcctgctgctggcctacaaggccgacccggacctgcgcaacctg
gccgggcagacaccgctggccggcgctgcgttcaagggcgacctggcgatggtcgaactg
ctcctcgccggcggcgccgacgtcgagggcgcctcggccgacggcaagaccgcactgatg
atggcggccatgttcaaccaggccgaggtcgcctccagcctgctggcccacggcgcccgt
cgtgacgcccaggacgccgccgggctgacgccgctggcggcggcgcggatgatgaatgcc
gaggccacggtcgcgctgctcagccggccccactga

DBGET integrated database retrieval system