KEGG   Pseudomonas aeruginosa MTB-1: U769_08920
Entry
U769_08920        CDS       T02951                                 

Definition
(GenBank) chromosome segregation protein ScpA
  KO
K05896  segregation and condensation protein A
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:paem03036]
    U769_08920
Chromosome and associated proteins [BR:paem03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    U769_08920
SSDB
Motif
Pfam: SMC_ScpA Imm19 Rad21_Rec8
Other DBs
NCBI-ProteinID: AHB55025
LinkDB
Position
1903241..1904131
AA seq 296 aa
MQDDNPANADTPPAEPAAERVPLQLALVYGEAVTELPQDLYIPPDALEVFLEAFEGPLDL
LLYLIRKQNIDILDIPVAEITRQYMGYVELMKAVRLELAAEYLVMAAMLAEIKSRMLLPR
SAEAEEEEEDPRAELIRRLQEYERFKKAAEDLDELPRVGRDVLVPAVAAPEARARKLLPE
LALQELMLVMGEMLRRADLFESHQVTREVLSTRERMSEVLERLKGGAFVPFIQLFTLEEG
KLGVVVTFMAILELVKEQMVELVQNEAFGAIHVRLRIAREAEEGETLEEALEDDFE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcaggacgataacccggccaacgccgacacccctccagccgaacccgccgccgagcgg
gtgccgctgcaactggcgctggtctacggcgaggcggtcaccgagctgccgcaggacctc
tatatcccgccggacgcgctggaggtcttcctcgaggccttcgagggcccgctcgacctg
ctgctgtacctgatccgcaagcagaacatcgacatcctggatatcccggtggcggaaatc
acccgccagtacatgggctatgtcgagctgatgaaggcggtgcgcctggagctggccgcc
gagtacctggtgatggcggcgatgctggcggagatcaagtcgcgcatgttgttgccgcgc
tcggcggaagccgaggaggaagaggaagatccgcgggccgagctgatccgccgcctgcaa
gagtacgaacggttcaagaaggccgccgaagacctcgacgaactgccccgggtcggccgc
gacgtgctggtgccggcggtggctgctcccgaggcgcgggcgcgcaagctgctgccggag
ctggcgctgcaggagctgatgctggtgatgggcgagatgctgcgccgcgccgacctgttc
gagagccaccaggtgacccgcgaggtactgtccacccgcgaacgcatgagcgaagtgctg
gagcgcctgaaaggcggcgccttcgtgcccttcatccagttgttcaccctggaggagggc
aagctcggcgtggtggtcaccttcatggcgatcctcgaactggtcaaggagcagatggtg
gaactggtgcagaacgaggctttcggcgccatccatgtgcgcctgcggatagcccgcgaa
gcggaggaaggcgaaaccctggaggaagccctggaagacgatttcgagtga

DBGET integrated database retrieval system