KEGG   Pseudomonas aeruginosa MTB-1: U769_10330Help
Entry
U769_10330        CDS       T02951                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paem00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U769_10330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paem02000]
    U769_10330
Transporters [BR:paem02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    U769_10330
   Histidine transporter
    U769_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHB55303
LinkDB All DBs
Position
complement(2212695..2213384)
Genome map
AA seq 229 aa AA seqDB search
MFLDGFGPQILAGTLVTLKLALGSLLGAVLIGLLGASAKLAANRPLRALASGYTTLIRSV
PDLVIMLLLFFSLQILLNRVTDALGIAQVDIDPFAAGCVTLAFIYGAYFTETFRGAFQAV
PAGQVEAAQAYGMGRWRVFRRVLLPQMLRYALPGIGNNWQVLVKSTALVSIIGLGDLVKA
TQDAGKGTLQFFHFTLVCGLIYLAITAISNAALLWLERRSSLGVRRPLP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcgacggcttcggcccgcagatactcgccggcaccctggtgaccctgaagctg
gcgctgggctccctgctcggcgccgtgctcatcggcctcctcggcgccagcgccaagctc
gccgccaaccgcccgctgcgcgccctggccagcggctatacgacgctgatccgcagcgtc
cctgacctggtcatcatgctgttgctgttcttcagcctgcagatcctcctcaaccgcgtc
accgacgccctcggcatcgcccaggtcgacatcgacccgttcgccgccggctgcgtcacc
ctggcgttcatctatggcgcctacttcacggaaaccttccgcggcgccttccaggcggtc
ccggccggccaggtcgaagccgcgcaagcctacggcatggggcgctggcgagtgttccgc
cgggtactcctgccgcagatgctgcgctacgccctgccgggcatcggcaacaactggcag
gtgctggtcaagtccaccgcgctggtctcgatcatcggcctcggcgacctggtcaaggcc
acccaggacgccggcaagggcaccctgcagttcttccacttcaccctggtctgcgggctg
atctacctggccatcaccgcaatctccaacgccgcgctgctgtggctggagcggcgcagc
tcgctgggcgtcaggaggccactgccatga

DBGET integrated database retrieval system