KEGG   Pseudomonas aeruginosa MTB-1: U769_13110Help
Entry
U769_13110        CDS       T02951                                 

Definition
(GenBank) peptide synthase
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AHB55848
LinkDB All DBs
Position
2811052..2824080
Genome map
AA seq 4342 aa AA seqDB search
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAH
AQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLV
LTTADLREPLLQMNAQLSAANAPQLLCVDQLDPAVAEAWDEPQVRPEHIAFLQYTSGSTA
LPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCSERVAESALERLDLSGWRVAFSGSEP
IRQDSLERFAEKFAASRFEASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRI
AEGAGSVLMCCGRSQPEHAVLIVDAASGEVLGDDNVGEIWAAGPSIAHGYWRNPEASAKT
FVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGR
VAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELIDSIRQAVAEAYQEAPKVVALLNPGAL
PKTSSGKLQRSACRLRLEDGSLDSYALFPGLQAVQEAQPPAGDDELLARIGEIWKARLGV
AQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLHAFSATVARQLAAGL
PAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSAAYNIPGGLRLRGELDEAALRASFQR
LVERHEALRTRFLERDGAALQRIDERGEFAWQFVDLAALAEHERAAAAAQRREAEAQQPF
DLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAP
LELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDAAPVLELATDHPRTARQASPAARYSL
RVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLV
GFFINTLVLRGTPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFN
HQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFDEASIR
RFAAQYLELLRQVAEDPQRCLGDIALVDAEQAARLAEWGSAPCEPARAWLPELLERQLAQ
SAERVALEWDGGSLGYAELHARANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIIK
AGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDNWPS
QAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDGDDVLMQKAPV
SFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVELVRQFGVTTLHFVPPLLQLFIDEPG
VAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERS
PIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLGLARGYLGRPALSAERFVADPFSADG
ERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREG
VAGSQLVGYYTGAAGAEAEAEQNQRLRAALQAELPEYMVPAQLMRLAQMPLGPSGKLDTR
ALPEPVWQQREHVEPRTELQRRIAAIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTR
QACDVELPLRALFEASELEAFCEQVRAAQAAGRTDSHGAIRRIDREQPVPLSYSQQRMWF
LWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVDGVPVQRVHGD
GGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCMVKMAEREHYLVVTL
HHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLESGERQRQLD
YWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFDLSPELAERVRRFNAARGLTMFMTMT
ATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQV
RQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIA
NDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIA
ELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDAR
SNRLARVLRSHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIE
DSGVRLLLSHAALFEALGELPAGVVRWCLEEDGPALDAEDPAPLAALSGPQHQAYLIYTS
GSTGKPKGVAVSHGEIAMHCAAVIERFGMRADDCELHFYSINFDAASERLLAPLLCGARV
VLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLESQGRQLPVRMCITGGEALTG
EHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPERLEEGAASVPIGSVVGARVAYILDA
DLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNG
QVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAE
QDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTANGKLDRRALPAPDPALNRQA
YEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDL
FQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLACREHWNQSLLLQPRQ
AIDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLREQELLWHVPVQSFDECAELF
AKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLVVDGVSWRVLLEDLQQVYRQLDEG
AEPALPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQSAEWPCDRPQGDNREALA
ESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSTLVQLEGHGREAL
FDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVR
QAMAALPTAPITFNYLGQFDQSFADALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGEL
VLRWTYSRERYDAQTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDAL
AVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVAR
HEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSELPEDGHEERLQALHKREREAGFDLL
EQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYGALGEGRPANLPTPPR
YRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLD
AADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVG
LFINSIPLRVQMPAAGQRCTVREWLNRLFERNLELREHEHLPLVAIQESSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAP
TVERLLGEFKRLLLALADGFHGELEALPLLGEDERDFLLDGCNRSARDYPLEQGYVRLFE
AQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMI
VGSFKAGAGYLPLDPGHPTQRLTRIVELSRTPVLVCTQACREQALALFDELGCVDRPRLL
VWDEIQQGEGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLEL
DENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAIAHDPQGLLAHVGEQGITVLESV
PSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAF
FRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGD
PLRTAQAFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGFRIELGEIEAR
LHERADVREAAVAVQEGANGKYLVGYLVPGETQRSSADSPAGLMVEQGAWFERIKQQLRA
DLPDYMVPLHWLVLDRMPLNANGKLDRKALPALDIGQMQNQAYQAPRNELEETLARIWAE
VLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECTTVEELASYIESLA
PSEISEQKAERLNDLMSKLEML
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttcccaccaccctggtccaggccctgcgtcgccgcgccgtc
caggagcccgagcgcctggcgctgcgcttcctcgccgaggacgatggcgaaggcgtggtc
ctcagctatcgcgatctcgacctgcgcgcgcggagcatcgccgcggccctgcaggcccat
gcgcagctgggcgatcgcgcggtgctgctgtttcccagcggccccgactacgtcgcggcg
ttcttcggttgcctgtatgccggggtcatcgcggtgccggcctatccgccggagtcggcg
cgccgccatcaccaggaacgcctgttgtcgatcatcgccgacgccgagccgcgcctggtc
ctgaccaccgctgacctgcgcgagccattgctgcagatgaacgcgcaactgtccgccgcc
aacgccccgcaactgctctgcgtcgaccagttggacccggccgttgccgaggcctgggac
gagccgcaagtgcgtcccgagcacatcgccttcctccagtacacctccggttcaaccgca
ctgcccaagggcgtgcaggtcagccatggcaacctggtcgccaacgaggtgttgatccgc
cgaggcttcggcatcggtgccgacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcctgctgcaaccgatcttcagcggcgtaccctgcgtgctgatg
tcgccgcgctacttcctcgaacgtccggtgcgctggctggaagccatcagccagtacggc
ggcaccgtcagcggcggtcccgatttcgcctaccggctgtgcagcgagcgggtcgccgag
tcggccctggagcgtctcgacctgagcggctggcgggtagccttctccggttccgagccg
atccgccaggacagcctggaacgcttcgccgagaaattcgccgccagccgcttcgaggcg
tccagtttcttcgcctgctacggcctcgccgaggcgaccctgttcgtcaccggcggccag
cgcggccagggcattcccgccctggcggtggatggcgaggcgctggcgcgcaaccgcatc
gccgaaggcgcaggcagcgtgctgatgtgctgcggccgcagccagccggaacacgccgtg
ctgatcgtcgacgcggcgagcggcgaggtcctcggcgacgacaacgtcggcgagatctgg
gccgccgggccgagcatcgcccacggctactggcgcaacccggaagcctcggcgaagacc
ttcgtcgagcgtgacgggcgtacctggctgcgcaccggcgacctcggtttcctccgcgac
ggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtccgcggccacaacctc
tatccgcaggacatcgaacgcaccgtcgagagcgaggtgccgtcggcgcgcaagggcagg
gtcgcggccttcgcggtcacggtcgatggcgaggaaggcatcggcattgccgccgagatc
ggacgcggcgtccagaaatcggtgccggcccaggagctgatcgactcgatccgccaggcg
gtggccgaggcctaccaggaagcgccgaaggtggtggcgctgctcaatcccggcgccttg
ccgaagacatccagcggcaagctgcaacgttccgcctgccgcctgcgcctggaagacggc
agcctggacagctatgcgctgtttcccggcctccaggccgtgcaggaggcgcagccgccg
gcaggcgacgacgaactgctggcacgcatcggcgagatctggaaggcccggctgggcgtg
gcgcaggtagcgccgcgcgatcacttcttcctgcttggcggcaattccatcggcgccgcc
caggtggtcgcccaggtgcgcgacagtctcggtgttgccctcgacctgcgccaactgttc
gaggcgccgaccctgcacgccttcagcgccacggtggcccgccaactggccgccggcctg
ccggccgaggcaccgatggcgcacctgccgcgcggtgtcgacctgccgcagtcggcggcg
cagcagcgtctctggctgacctggcagatcgatccgcagagcgccgcctacaacatcccc
ggcggcctgcgcctgcgcggcgagctggacgaagcggcgctgcgcgccagcttccagcgc
ctggtcgaacgccacgaagcgctgcgcacgcgtttcctcgagcgcgacggcgcggccttg
cagcgtatcgatgagcggggcgaattcgcctggcagttcgtcgacctcgccgcgctggcc
gagcacgaacgcgccgcggctgccgcgcagcgccgcgaagccgaggcgcagcagccgttc
gacctggaaaaggggccgctgctgcgggtcagcctggtgcgtctggacgaacaggagcac
cagctctgggtcaccctgcatcacatcgtcgccgatggttggtcgctgaacctgctgctc
gacgaattctcgcggctctacgccgaagcctgcggcggccagccggccgacctggcgccg
ctggaactgcactacgccgagttcgccgcctggcaacggcagtggctggacgcgggcgag
ggcgcccgccaactggcctactggcgggagcgcctgggcgacgcggcgccggtgctggaa
ctggccaccgaccatccgcgcacggcgcgccaggcgtcgcccgccgcgcgctacagcctg
cgggtcgacgaagccctggcgcgggctatccgcgaggccgcgctggaccatgaggcgagt
gtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgccacagcgggcagggc
gagatccgcatcggcgtgcccagcgccaaccgccagcgcctggagacccaggggctggtc
ggcttcttcatcaacaccctggtcctgcgcggcacgccccgggcgcgccagccgttcgcc
gcgttgctcggcgaggctcgcgaggcgaccctcggcgcccaggccaaccaggacctgccg
ttcgaccaggtgctcgcagcctgcggccagggcggccagttgttccaggtgttgttcaac
caccagcagcgcgacctgtcggcgttgcgccggctgcccggcctgctcgccgacgagctg
ccctggcacagccgcgaagccaagttcgacctgcaactgcagagcgaggaggacgctcgc
ggtcgcctgaccctgaatttcgactacgccgcggacctcttcgacgaggccagtatccgg
cgtttcgccgcgcaatacctggagttgctgcgccaggtcgcggaagacccgcagcgctgc
ctcggcgatatcgccctggtcgacgccgagcaggcggcgcgcctcgccgaatggggcagc
gcgccctgcgagccggcgcgcgcctggctgccggagctgctggagcggcaactggcgcag
tccgccgaacgcgtcgccctggagtgggacggcggcagcctcggctacgccgaactgcac
gcccgggccaaccgcctggcccactacctgcgcgacaagggcgtcggcccggacgtgcgg
gtagcgatctgcgccgagcgttcgccgcaactgctggtcggtctgctggcgatcatcaag
gcgggcggcgcctacgtgccgctggacccggactaccccagcgaacgcctggcctacatg
ctcgccgacagcggcgtcgagctgctgctgacccaggcccatctgttcgagcgcctgcct
ggcgcggagggcgtcacgccgatctgcctggacagcctcaagctcgacaactggccgagc
caggcaccgggcctgcacctgcacggcgacaatctcgcctacgtcatctacacctccggt
tccaccggccagccgaagggcgtgggcaatacccacgcggcgctggccgagcgcctgcaa
tggatgcaggcgacctacgccctcgacggcgacgacgtgctgatgcagaaggcaccggtg
agcttcgacgtgtcggtgtgggagtgcttctggccgctggtcaccggttgccggctggtc
ctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaactggtgcggcagttc
ggggtgaccacgctgcacttcgtgccgccgctgctgcaactgttcatcgacgaacccggt
gtcgccgcctgcggcagcctgcgccgcctgttctccggcggcgaggcgcttccggcggag
ctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcataaccgctacgggccg
accgagaccgccatcaacgtcacccactggcaatgccgcgcggaagacggcgagcgttcg
ccgatcggccggccgctgggcaacgtggtctgccgcgtgctggacgccgagttcaacctg
ctgccggccggcgtcgccggcgagctgtgcatcggcggcctgggcctggcccgtggctac
ctggggcgcccggcgctgagcgctgagcgcttcgtcgccgatccgttctcggccgacggc
gagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgacggcgtgctggaatac
ctcggccgcctcgaccagcaggtcaagctgcgtggcttccgtatcgagccggaggagatc
caggcacgcctgctggcgcagccgggggtggcccaggcggtggtggtgatccgcgaaggc
gtggccggcagccagttggtcggctactacaccggcgctgccggcgccgaggcggaagcc
gagcagaaccagcgtctgcgcgccgcgctacaggccgaactgccggaatacatggttccg
gcacagttgatgcgcctggcgcagatgccccttggcccgagcggcaagctggatacgcgg
gcgctaccggagccggtctggcagcagcgcgagcacgtcgagccgcggaccgagctgcaa
cggcgcattgccgcgatctggagcgaagtgctcggcctgccgcgggtcggcctgcgcgac
gatttcttcgaactcggcgggcattccctgctggccacccgcatcgtctcgcgcacacgc
caggcctgcgacgtcgaactgccgttgcgcgcgctgttcgaggccagcgaactggaggcc
ttctgcgaacaggtccgcgcagcccaggccgccggacgtaccgacagccacggcgcgatc
cgccgcatcgaccgcgagcagccggtgccgctgtcctactcgcagcagcgcatgtggttc
ctctggcaactggagccggacagcccggcctacaacgtcggcggcctggcgcgcctgagc
gggccgctggacgtggcgcgcttcgaggccgcgctacaggccctggtgcagcgccacgag
accctgcgcaccacgttccccagcgtcgacggcgtgccggtacagcgcgtacatggcgat
ggcggcctgcacatggactggcaggacttctccgcgctcgaccgcgacagtcgccagcag
cacctgcagaccctcgccgacagcgaggcgcaccgtcccttcgaccttgagagcgggccg
ttgctgcgggtctgcatggtgaagatggccgagcgcgagcactacctggtggtgaccctg
caccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgaactgggcgcgctc
tacgaggccttcctcgacgaccgcgaatcgccgctggagccgttgccggtccagtacctg
gactacagcgtgtggcagcgcgagtggctggagagcggcgagcgccagcgccagctcgac
tactggaaggcccagctgggcaacgagcatccgctgctcgaactgccgggcgaccggcca
cgcccgccggtgcagagccaccagggcgacctctaccgcttcgacctgagccccgagctg
gccgagcgcgtgcgccgcttcaacgccgcccgcgggctgaccatgttcatgaccatgacc
gccacccttgcggccttgctctaccgctacagcggccagcaggacctgcgtatcggcgcg
ccggtggcgaaccgcatccgcccagagagcgaagggctgatcggcgccttcctcaatacc
caggtgctgcgctgccggctcgacggacagatgagcgtcggcgagctgcttgagcaggtg
cggcagaccgtgatcgatggccagtcgcaccaggacctgccgttcgaccacctggtggaa
gccctgcaaccgccgcgcagcgccgcctacaacccgttgttccaggtgatgtgcaacgtc
cagcgctgggagttccagcagacccggcaactggccgggatgaccgtcgagtacatcgcc
aacgatgcgcgggcgaccaagttcgacctcaacctggaggtcaccgacctcgaccagcgc
ctcggctgctgcctgacctacagccgcgacctgttcgacgaaccgcgcatcgcgcggatg
gccggacactggcagaacctgctggaggcgctgctgggcgacccgcagcggcgcattgcc
gaattgccgctgttcgccgccgaggagcggaagcaactgctgctcgccggcacggccggc
gaggcagggctccaggacaccctccatggcctgttcgccgcccgcgtggcggccagccca
caggccccggcgctgaccttcgccggacagaccctgagctatgccgaactcgacgcccgc
tccaaccgtctggcgcgcgtcctgcgcagtcacggcgtcggcccggaagtgcgggtcggc
ctggccctggagcgttcgctggagatggtcgtcggcctgctggcgatcctcaaggccggc
ggcgcctacgtgccgctggacccggaatatccgctggagcgcctgcaatacatgatcgag
gacagcggcgtacgcctgctgctcagccacgcggcgctgttcgaggccctcggcgagctg
ccggcgggcgtggtgcgctggtgcctcgaggaggacggcccggcgctggacgccgaggac
cccgcgccgctggcagcgctgagcgggccgcagcaccaggcctacctgatctatacctcc
ggctccaccggcaagccgaagggcgtggcggtctcccacggcgagatcgccatgcactgc
gccgcggtgatcgagcgcttcggcatgcgcgccgacgattgtgaactgcacttctattcg
atcaacttcgacgccgccagcgagcgcctgctggccccgttgctgtgcggcgcccgcgtg
gtgctgcgggcccagggccagtggggcgcggaggaaatctgcgagctgatccgcgcggag
ggcgtgagcatcctcggcttcaccccgagctacggcagccagctcgcccagtggctggag
agccagggccggcagttgccggtgcgcatgtgcatcaccggcggcgaagcgctgaccggc
gagcacctgcaacggattcgccaggccttcgccccggcgtcgttcttcaatgcctacgga
ccgaccgagacggtggtcatgccgctggcctgcctggctcccgaacgcctggaggagggt
gccgccagcgtgccgatcggcagcgtggtcggcgcgcgggtcgcctacatcctggatgcc
gacctggccctggtgccgcagggcgcgaccggcgaactctacgtcggcggcgccggcctg
gcgcgcggctaccatgagcgtccggcgctcagcgccgagcgcttcgtgcccgatcccttc
gctgccgagggcggccgcctgtaccgcaccggcgacctggtgcgcctgtgcgacaacggc
caggtggaatatgtcggccgcatcgaccaccaggtgaagatccgtggcttccgcatcgaa
ctgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgcgaagcgctggtcctg
gcgctcgacagcccgagcggcaagcagttggccggttatgtcgccagcgcggtggccgag
caggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacgcacctcaagcagcaa
ttgccggactacatggtgccggcccacctgctgttgctcgccagcctgccgctgaccgcc
aacggcaagctcgaccgccgcgcgctgccggcgcccgacccggcgctcaaccggcaggcc
tacgaggccccgcgcagcgtgctggagcagcaactggccggggtctggcgcgaggtgctg
aacgtcgagcgggtaggcctcggcgacaacttcttcgaactgggcggcgattcgatcctg
tcgatccaggtggtcagccgcgcccgccagctcggcatccacttcagcccccgcgacctg
ttccagcaccagaccgtgcagagcctcgccgcggtggcccggcacagccaggccagccag
gccgagcaggggccggtgcagggcgacagcgcgctgacgccgatccagcactggttcttc
gacctgccgctggcgtgccgcgaacactggaaccagtcgctgctgttgcagccgcggcag
gccattgacctcggtctgctgcgcaagtccctgcaacgcctggtcgaacagcatgatgcc
ctgcgcctggcgttccgccaggtcgacggcgagtggctggcgcagcatcgtccgctgcgc
gaacaggaactgctctggcacgtcccggtgcaatccttcgacgaatgcgccgagctgttc
gccaaggcccagcgcagcctcgacctcgaacaggggccgctgctgcgcgcggtgctggtg
gacggcccggccggcgagcaacgcctgctgctggcgatccaccacctggtggtggacggg
gtgtcctggcgggtgctgctggaggatctgcaacaggtctaccgtcagctcgacgagggc
gccgaaccggcgctgccggccaagaccagcgccttccgcgactgggccggacgcctgcag
gcctacgccggcagcgaatcgctgcgcgaggagctgggctggtggcaagcccggctgggc
gggcagtcggccgagtggccatgcgaccgccctcagggcgacaaccgcgaggcgctggcg
gaaagtgtcagcctgcggctcgacccgcaacgtacccggcaattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacctgctgctgaccgccctcgctcgcgtgctctgc
cgctggagcgggcagccgtcgacgctggtgcagttggaagggcatggccgcgaggcgctg
ttcgacgatatcgacctgacccgcagcgtcggctggttcaccagcgcctacccgttgcgc
ctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaaggaacagctccgcgcg
gtgccgcacaaaggcctcggctacggcgtgctgcgctacctcgccgatccggcggtgcgc
caggcgatggccgcgctgcccacggcgccgatcaccttcaactacctcggacagttcgac
cagagcttcgccgacgccctgttccagccgctggaccagcccaccgggccgatccacgac
gagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtctacggcggcgagctg
gtgctgcgctggacctacagccgcgagcgctacgacgcgcagacggtgaacgagctggcg
caggcctatctcgccgaactgcaggcgctgatcgagcattgcctggaagacggcgccggc
ggcctgaccccgtccgacttcccgctggcgcaactgagccaggcgcaactggacgccctg
gcggtgccggccggcgagatcgaggacgtctatccgctgaccccgatgcaggaagggttg
ctgttgcacaccctgttggaaccgggcaccggcatctactacatgcaggaccgctaccgg
atcgacagcccgctcgatcccgagcgcttcgccgccgcctggcaggcggtggtggcccgc
cacgaggcgctgcgcgcgtcgttcgtctggaatgccggcgaaacgatgttgcaggtgatc
cacaagcccggtcgcacccgcatcgagttcctcgactggagcgagctgccggaggacggc
cacgaggagcgcctgcaagcgctgcacaagcgcgagcgcgaggccggcttcgacctgctc
gaacagccgccgttccacctgcgcctgatccgcctgggcgaggcgcgctactggttcatg
atgagcaaccaccacatcctcatcgatgcctggtgccgtggcctgctgatgaacgacttc
ttcgagatctacggcgccctcggcgaaggccgcccggcgaacctgccgacgccgccgcgc
taccgcgactacatcgcctggctgcaacgccaggacctggagcaatcgcgtcgctggtgg
agcgagagcctgcgcggcttcgagcggccgaccctggtacccagcgaccgcccgttcctc
cgcgagcacgccggcgagagcggcgggatgatcgtcggcgaccgctacacgcgtctggac
gccgccgacggcgcgcgcctgcgtgaactggcgcagcgctaccaactcaccgtcaacacc
ttcgcccaggccgcctgggcgctgaccctgcgccgcttcagcggcgagcgcgacgtgctg
ttcggcgtcaccgtggccgggcgtccggtgggcatgccggaaatgcagcgcaccgtcggc
ctgttcatcaacagcatcccattgcgcgtgcagatgccggccgccggccagcgctgcacg
gtgcgcgagtggctgaaccggctgttcgagcgcaacctggagttgcgcgagcacgagcac
ctgcccctggtggccatccaggaaagcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgagaacgccccggtggaagtctcggtgctggaccgcgcgcagagc
ctgaacgccagttccgactccgggcgtacccacaccaacttcccgttgaccgtggtctgc
tatccgggcgatgacctcggcctgcacctgtcctacgaccagcgctacttcgaggcgccg
accgtcgagcgcctgctcggcgagttcaagcgcctgctgctggccctggccgacggtttc
catggcgaactggaggccttgccgctgctcggcgaggacgagcgcgacttcctcctcgac
ggctgcaaccgcagcgcccgcgactacccgctggagcaaggttacgtgcggctgttcgag
gcgcaggtggcggcccatccgcagcgcatcgccgccagttgcctggagcagcgctggagc
tacgccgagctgaaccgccgggccaaccgtctcggccacgccctgcgcgccgccggcgtc
ggcatcgaccagccggtggcactgctggccgagcgcggcctcgacctgctcggcatgatc
gtcggcagcttcaaggccggtgccggctacctgccgctcgaccccggccatccgacccag
cgcctgacccggatcgtcgagctgagccgcacgccggtactggtctgcacccaggcctgc
cgtgagcaggcgctggcgctgttcgacgaactcggctgcgtcgaccggccgcgcctgctg
gtgtgggacgagatccagcagggcgagggcgccgagcatgatccgcaggtctacagcggg
ccgcagaacctcgcctacgtgatctacacctccggctccaccggactgccgaagggcgtg
atggtggagcaggcgggcatgctcaacaaccagttgagcaaggtcccgtacctggaactg
gacgagaacgacgtgatcgcccagaccgcctcgcagagcttcgacatctcggtctggcag
ttcctcgccgcgccgttgttcggcgcccgcgtggcgatcgtgccgaacgccatcgcccac
gatccgcagggcctgctggcgcacgtcggcgaacagggcatcacggtgctggaaagcgtg
ccgtcgctgatccagggcatgctcgccgaagagcgccaggccctcgacggcctgcgctgg
atgctgcccaccggcgaggcgatgccgccggaactggcgcgccagtggctcaagcgctac
ccacggatcggcctggtgaatgcctacgggccggcggagtgttccgacgacgtggcgttc
ttccgcgtcgacctggcctccaccgagagcacctacctgccgatcggcagtcccaccgac
aacaaccgcctgtacctgctcggtgccggcgccgacgacgccttcgaactggtgccgctg
ggcgcggtgggcgagctgtgcgtggccggcaccggcgtcggtcgtggctacgtcggcgat
ccgctacgcaccgcccaggccttcgtcccgcatccgttcggcgcgccgggcgagcgtctg
taccgtaccggcgacctggcgcggcggcgcgccgacggagtgctggaatatgtcgggcgg
atcgaccaccaggtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgc
ctgcacgaacgcgccgacgtccgcgaggcggcggtggcggtccaggaaggggcgaacggc
aagtacctggtgggctacctggttcccggcgagacacagcgttccagcgccgactcgccg
gccggactgatggtggagcagggcgcctggttcgagcggatcaagcagcaactgcgcgcc
gacctgccggactacatggtgccgctgcactggctggtgctggaccggatgccgctcaac
gccaacggcaagctcgaccgcaaggcgctgccggcgctggacatcggccagatgcagaac
caggcctaccaggccccgcgcaacgaactggaggaaaccctggcacggatctgggccgag
gtgctgaaggtcgagcgggtcggggtgttcgacaacttcttcgaactcggggggcattcg
ctgctggccacccagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgcta
cgggcgatgttcgaatgcaccacggtggaagagctggccagctacatcgagtccctggcc
ccgagcgagatcagcgagcagaaggccgagcgcctgaacgacctgatgtcgaagctggaa
atgctctga

DBGET integrated database retrieval system