KEGG   Pseudomonas aeruginosa MTB-1: U769_13885
Entry
U769_13885        CDS       T02951                                 

Definition
(GenBank) gluconate 2-dehydrogenase
  KO
K06152  gluconate 2-dehydrogenase gamma chain [EC:1.1.99.3]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00030  Pentose phosphate pathway
paem01100  Metabolic pathways
paem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U769_13885
Enzymes [BR:paem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.3  gluconate 2-dehydrogenase (acceptor)
     U769_13885
SSDB
Motif
Pfam: Gluconate_2-dh3
Other DBs
NCBI-ProteinID: AHB56005
LinkDB
Position
complement(3026610..3027326)
AA seq 238 aa
MPDDKAVNGRRDFLRKTLTVIPAVTLAGYGVGHAMQTPAAEQDKPRERYQPRFFTNTEWA
FVNAAVARLIPSDDNGPGAIEAGVPEFIDRQMETPYGHGALWYMQGPFVTDAAPEFGHQL
KLVPRDIYRVGIAALERWSKANQGKPFAELEPSAQDDILQRLEAGQIDLQDLPAKLLFGQ
LLQNTHEGFFSDPQHGGNRGLVGWKLVGFPGARADFMDWADRGEKYPFPPVAISGERG
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcccgatgacaaggccgtcaacggccgccgcgacttcctgcgcaagaccctgaccgtg
atcccggcggtgaccctggccggctatggcgtcggccatgccatgcagacgcccgccgcc
gagcaggacaaaccccgcgaacgctaccagcctcgcttcttcaccaacaccgaatgggct
ttcgtcaacgccgcggtggcgcgactgatccccagcgacgacaacggccccggcgccatc
gaggccggggtgccggagttcatcgaccgacagatggaaaccccctacgggcacggcgca
ctctggtacatgcagggaccgttcgtcaccgacgccgcgccggagttcggccatcagttg
aagctggtgccacgcgacatctaccgggtcggcatcgccgccctggaacgctggagcaag
gccaaccagggcaagccgttcgccgagctggagccgtcggcgcaggacgacatcctgcaa
cgcctggaagccggccagatcgacctgcaggacctgccggccaagctgctcttcggccag
ttgctgcaaaacacccacgaaggcttcttctccgatccgcagcacggcggcaatcgcggc
ctggtgggctggaagctggtcggtttccccggcgcccgcgccgacttcatggactgggcc
gaccgcggcgagaagtatcccttcccgccggtggcgatttccggcgagaggggttga

DBGET integrated database retrieval system