KEGG   Pseudomonas aeruginosa MTB-1: U769_14520Help
Entry
U769_14520        CDS       T02951                                 

Definition
(GenBank) membrane protein
  KO
K07027  glycosyltransferase 2 family protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99986 Glycan metabolism
    U769_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPG_synthase_TM
Motif
Other DBs
NCBI-ProteinID: AHB56134
LinkDB All DBs
Position
3169851..3170846
Genome map
AA seq 331 aa AA seqDB search
MNGGGHATASAAPRRAHWRWLRRLLTLAFFVLVPVLLFLLVKNLDWQEVRHALGEYRPAT
LFLGLLLAAAGYTVFSSFDLLSRYYIGHSLPKRRVFTVAFVCNAFNLNLSSWVGAVALRY
RLYSRLGLGIADITRILTFSLVTNWFGYLLLAGILFSCGLPALPPGWKLGSDGLRLIGAL
LLALAAGYLLACRFARRRAWGWREHRLTLPSWRLAALQGLLGASNWSLMALLLYSLLPHG
VDYPSVLAILLISSIAGVITHIPAGLGVLEAVFIALLQGRLSQGVLLAALIGYRVLYFLL
PLALACVVYLLLERRAIRLRRKQRRLRQGQA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcggcggtcacgcaactgcctcggcggcgccacgccgcgctcactggcgctgg
ctgcgcaggctgctgaccctggcgttcttcgtgctggtcccggtgctgctgttcctcctg
gtgaagaatctcgactggcaggaagtccgccacgccctcggcgagtatcgccccgcgacc
ctgttcctcggactgctgctggcggccgccggctatacggtgttcagcagtttcgacctg
ctcagccgctactacatcggccactcgctgcccaagcggcgggtcttcaccgtggccttc
gtgtgcaatgcgttcaacctcaacctgagttcctgggtcggcgccgtggcgctgcgctat
cgcctgtacagccggctcggcctgggcatcgccgacatcacccggatcctcaccttcagc
ctggtgaccaattggttcggctacctgctgctcgccggcatcctgttcagctgcggcctg
ccggccttgccgccgggctggaagctcggcagcgacggcctgcgcctgatcggcgccctg
ctcctggcgctggccgccggctacctgctggcctgccgtttcgcccgacgccgcgcctgg
ggctggcgcgagcatcggctgaccctgccgtcctggcggctggcggcccttcaaggcctg
ctcggagcgagcaactggtcgctgatggcgctgctgctgtacagcctgctgccgcacggc
gtggattacccgagcgtcctggcgatcctcctgatcagcagcatcgccggggtcatcacc
catatcccggccgggctcggggtgctcgaagcggtgttcatcgccctgctccaggggcgc
ctgtcccagggcgtgctgctggccgcgttgatcggctaccgggtgctgtatttcctccta
cccctggcgctggcctgcgtggtctacctgctgttggagcgccgggcgatccgcctgcgc
cgcaaacagcgccgcctgcgccagggccaggcctga

DBGET integrated database retrieval system