KEGG   Pseudomonas aeruginosa MTB-1: U769_14530Help
Entry
U769_14530        CDS       T02951                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00500  Starch and sucrose metabolism
paem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    U769_14530
Enzymes [BR:paem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     U769_14530
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     U769_14530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: AHB56136
LinkDB All DBs
Position
complement(3173043..3176345)
Genome map
AA seq 1100 aa AA seqDB search
MARREKPVFLNDPQWYKDAVIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLKRIRAE
LDAHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQEDRYPI
TDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGIRRRLA
PLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGF
SRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQKAFGRGSLKML
APSNRRILAYLREYAEGERQDSILCVANLSRAAQAVELDLASHAGKVPVEMIGGMSFPPI
GELTYLLTLPPYGFYWFYLADATQMPSWHVAADERLPELPTLVVKQRLGELLQGASRNIL
EGETLPAYLPKRRWFAGEKGQPRLCYIVPLDEAEPRCALCEVEIDGLRYQLPLGFLDADQ
RGDSLPQLLALARLRRGRKVGLLTDAASLPLFARKVLAQLRAEAVIAHGDGEIQFIPAAG
LAELDDIADEDVLPFSVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRHGYPGI
APLLGEVRRVGADGEPHTLMILQGYLNNQGDAWNWTLDNLERAVRDEISAASEALEGQYD
SLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDEASVQAWALRIAEQLREAGKRL
SEPPRPLQGEAAEQARRLLERLPVLLERLPLLARQAAGGLLIRVHGDLHLGQVLMVQGDA
RFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADSARRKV
AMRYRSEARDAFLVGYRAAAAGLAHAWHGREGEGAALALACLEKAAYELLYEADYRPDWL
EVPLAGLAELTEHLLKGKNR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaaaccggtctttctcaacgacccgcaatggtacaaggacgcggtg
atctaccaggtccacgtgaaatccttctacgacgccaacaacgatggcatcggcgacttc
gccgggctgatcgagaagctcgactacatcgccgacctcggcgtgaacactctctggctg
ctgccgttctacccgtcgccacgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactacggcagcctcgccgacgcccgccggttcatcgccgaggcccatcga
cgcggtctgcgggtgattaccgagctggtgatcaaccacacctccgaccagcatccctgg
ttcatccgcgcccgccacgcgaagaagggatcgcgcgcccgcgactactacgtctggtcg
gacagcgacgagaaataccagggtacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtagcccaacagtactactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtcctgcgcgaggtgctcggggtgatgcgctactgg
ctggacatgggcgtcgacggcctgcgcctggacgcgattccctacctgatcgaacgcgac
ggcaccagcagcgagaacctgccggagacccaccaggtgctcaagcgcatccgcgccgag
ctggacgcgcactatcccgaccgcatgctgctggccgaggccaaccagtggccggaagac
acccggccgtacttcggcggcgaggatggcggcgagggcgacgaatgccacatggccttc
cacttcccgctgatgccgcgcatgtacatggccatcgcccaggaggatcgctatccgatc
accgacatcctgcgccagaccccggacatcccggccaattgccaatgggcgatcttcctg
cgcaaccacgacgagctgaccctggagatggtcaccgacgacgagcgcgactatctctgg
aaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatccgccggcgcctggcg
ccgctggtggagcgtgaccggcggcgcatcgagctgctgcacagcctgctgttgtcgatg
ccgggcacgccgaccctgtactacggcgacgagatcggcatgggcgacaacatctacctc
ggcgaccgcgacggcgtgcgcacgccgatgcagtggtcggtggaccgcaacggcggcttc
tcccgcgccgacccggcgaagctggtgctgccgccgatcctcgacccgctgtacggctac
cagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggatgcgc
cgcctgctcgccgtgcgcagccagcagaaggccttcggccgcggcagcctgaagatgctc
gcgccgagcaaccgacggatcctcgcctacctgcgcgaatacgccgagggcgaacggcag
gacagcatcctctgcgtggccaacctgtcgcgcgcggcccaggcggtggaactggacctc
gccagccatgccggcaaggtgccggtggagatgatcggcggcatgtcgttcccgccgatc
ggcgagctgacctacctgctgaccctgccgccctacggcttctactggttctacctggcc
gacgcgacgcagatgccgagctggcacgtggccgccgacgagcgcctgccggaactgccg
accctggtggtcaagcagcgcctcggcgagctgctgcagggcgcatcgcggaacatcctg
gaaggcgagacactgccggcctacctgccgaagcgccgctggttcgccggcgagaaaggc
cagccacggctctgctacatcgttccgctggacgaggcggagccgcgctgtgcgctgtgc
gaagtggagatcgacgggctgcgctaccagttgccgctgggcttcctcgacgccgaccag
cgcggcgacagcctgcctcagttgctggccctggcgcgcctgcggcgcgggcgcaaggtc
ggcctgctgaccgacgccgccagcctgccgctgttcgcccgcaaggtcctcgcgcaactc
cgcgccgaggcggtgatcgcccacggcgacggcgagatccagttcatcccggcggcggga
ctggcggaactggacgacatcgccgacgaagacgtcctgccgttctcggtggaacagtcc
aacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctgcgcaagatccttccg
gggctgcacccggaaatcgaggtcggcggctacctgacccgccacggctaccccggcatc
gccccgttgctcggcgaggtacggcgggtcggcgcggatggcgagccgcacacgctgatg
atcctgcagggctacctgaacaaccagggcgacgcctggaactggaccctggacaacctg
gagcgagccgtgcgcgacgagatatccgcggccagcgaggcgctcgaagggcaatacgac
agcctcgccgaactgcgcggcttcgccgccaacctcggcgcccggctcggcgagatgcac
agcgtactggccggcgagtcggacgatccggccttcggcagccgcgagagcgacgaagcc
agcgtccaggcctgggcgctgcgcatcgccgaacagttgcgcgaagccggcaaacgcctg
agcgagccgccacggccgttgcagggcgaggcggcggaacaggcgcggcgcctgctggaa
cgcctgccggtgctgctcgaacgcctgccgctgctggcccggcaggcagccggcgggctg
ctgatcagggttcacggcgacctgcacctgggccaggtgctgatggtccagggcgacgca
cgcttcatcgacttcgagggcgagccggcgcgcagcctggaagagcgccgccagcgccac
agtccgatgaaggacgtcggcggcatgctgcgctcgttcgactacgcggcggcgatggtc
ctgcgcaacgcgcagagcaccgatagctcggaacaggccgacagcgcccggcgcaaggtc
gccatgcgctatcgcagcgaagcccgcgacgccttcctggtcggctaccgcgccgccgca
gcgggcctcgcgcacgcctggcacggccgcgaaggcgagggcgcggcgctggccctggcc
tgcctggaaaaggccgcctacgaactgctctacgaagccgactaccgccccgactggctg
gaagtgcctctcgccggtctggccgaactcaccgaacacctcctgaagggcaagaaccga
tga

DBGET integrated database retrieval system