KEGG   Pseudomonas aeruginosa MTB-1: U769_16555Help
Entry
U769_16555        CDS       T02951                                 

Definition
(GenBank) membrane protein
  KO
K07090  uncharacterized protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    U769_16555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AHB56550
LinkDB All DBs
Position
3600669..3601448
Genome map
AA seq 259 aa AA seqDB search
MPFELAIDPSTLIILAVVAFLAGFIDAIAGGGGLLTIPALLTAGVPPHLALGTNKLSSTF
GAATASYTFYRRKLFHPGKWRNGLLATAIGAAIGAWAAHLLPAEWLNRMLPVVVFTCGLY
MLFGGTPKAPLDADAPVGRKRQWPQGLALGFYDGVAGPGTGAFWTVSSLLMYPLDLVRAS
GVARSMNFVSNIVALAVFVASGQVIWLLGLCMGASLMVGAYFGARTAIGGGAKFIRPVFI
LVVLALTARLAWQHWFSGA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcgaactcgcgatagaccccagcaccctgatcatcctggccgtggtggccttt
ctcgccggcttcatcgacgccatcgccggcggcggcggcctgttgaccatccctgcgctg
ctcaccgccggggtcccgccgcacctggcgctgggtaccaacaagctgagctcgaccttc
ggtgcggcgaccgccagctacaccttctaccggcgcaagctgttccatcccgggaagtgg
cgcaacggcctgctcgccaccgcgatcggcgccgccataggcgcctgggcggctcacctg
ctgcccgccgagtggctgaaccggatgctcccggtggtggtattcacctgcggcctctac
atgctcttcggcggcacgccgaaagcgccgctggacgccgatgcgccggtcggacgcaag
cgccagtggccgcagggcctcgccctgggcttctacgacggcgtggcgggaccgggcacc
ggagcgttctggaccgtcagctcgctgctcatgtacccgctggacctggtccgcgccagc
ggtgtggcgcggagcatgaacttcgtcagcaacatagtggcgctggcggtgttcgtcgcc
tccggccaggtgatctggttgctcggcctgtgcatgggtgcgtcgctgatggtcggcgcc
tatttcggcgcgcgcaccgctatcggcggcggggcgaagttcattcgcccggtgttcatc
ctggtggtcctggcgctgaccgcgcggctagcctggcagcactggttcagcggcgcctga

DBGET integrated database retrieval system