KEGG   Pseudomonas aeruginosa MTB-1: U769_17465Help
Entry
U769_17465        CDS       T02951                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:paem00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    U769_17465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paem02000]
    U769_17465
Enzymes [BR:paem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     U769_17465
Transporters [BR:paem02000]
 Other Transporters
  Pores ion channels [TC:1]
   U769_17465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AHB56726
LinkDB All DBs
Position
complement(3782486..3783088)
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYRSGNCYKIKLAMSLLGIDYQWVPVDILKGETQTPEFLAKNPNGKIPVLELED
GSCLWESNAILNFLADGSTLLPSEPRLRTQVLQWQFFEQYSHEPYVAVARFIKLYLGLPE
ARRAEFEEKKIGGYKALDVMEKQLSRTPFLVGEQFSIADITLYAYTHVAHEGGFDLTAYP
AIRAWIKRVGEVPGYVGMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtctacggtgattaccgttcgggcaactgctacaagatcaagctggccatg
tcgctgctcggcatcgactaccagtgggttccggtggacattctcaagggcgagacccag
accccggagttcctggcgaagaaccccaacggcaagataccggtgctggagctggaggac
ggcagttgcctgtgggagtccaacgccatcctcaacttcctcgccgacggcagcaccctg
ttgcccagcgaaccgcgcctgcgcacccaggtgctgcaatggcaattcttcgagcaatac
agccatgagccctatgtggccgtggcgcgcttcatcaagctctacctcggcctcccggaa
gcccgccgcgccgagttcgaagagaagaagatcggcggctacaaggccctcgacgtcatg
gagaaacagctgtcgcgcacgccattcctggtcggcgaacagttctccatcgccgatatc
accctctacgcctacacccatgtcgcccatgaaggcggcttcgacctgacggcctacccg
gcgatccgcgcgtggatcaagcgagtgggggaggtgccggggtatgtggggatgctggat
tga

DBGET integrated database retrieval system