KEGG   Pseudomonas aeruginosa MTB-1: U769_18990Help
Entry
U769_18990        CDS       T02951                                 

Definition
(GenBank) membrane protein
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AHB57033
LinkDB All DBs
Position
4111218..4112429
Genome map
AA seq 403 aa AA seqDB search
MPSSPSSLPSALVLLFAVACGLSVANVYYAQPLLDVLGAEFAIGQAGVGLLFGATQAGCA
LALLLVVPLGDLLERRRLMFVQLLLLVLSLLLVGFAGDTLGLALGLLGLGLLGTAMTQGL
LAYAAALAAPGERGRVVGAAQGGVVIGLLLARSLAGLLADLGGWRSVYLVSAASMGGLGL
LLWRVLPAAPSNELGLSYRQLLGSMFGLLASQRVLQVRGLLGLLMFAAFGVFWSSLVLLL
SAPPYSLSHSAIGAFGLVGALGALGAARTGSLADRGHAQALSGGALLLLLLSWLPLALGT
HSLVALILGVLLLDLAGQAIHVLNQSLVFAIDPRAHSRLVGCYMLFYAAGSGLGASAGTA
MYAWAGWDAVSLLGAAISLAALAFWWFTRGVGGEARTACANGA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccatcctcgccatcctccctcccctccgcgctggtgctgctgttcgccgtcgcctgc
ggtctcagcgtggccaacgtctattacgcccagccgctgctggacgtcctcggtgccgag
ttcgccatcggccaggccggggtcggcctgctgttcggcgcgacccaagccggttgcgcc
ctggcgctgctgctggtggtgccgctgggcgacctgctggagcggcgccggctgatgttc
gtccagctcctgctgctggtgctgtcgctgctgctggtgggcttcgccggcgataccctc
ggcctggcgctggggctgctcggactgggcctgctcggcaccgccatgacccagggactg
ctggcctacgccgcggcgctggcggcgcctggcgagcgcgggcgggtggtcggcgcggcg
cagggcggcgtggtgatcggcctgctgctggcgcgcagcctggccgggctgctcgccgac
ctcggcggctggcgcagcgtctacctggtctcggcagcgagcatgggcgggcttggcctg
ctgctctggcgggtactgccggcggcgccgagcaacgaactggggctgtcctaccggcag
ctgctcggctcgatgttcggcctgctggcgagccagcgcgtgctgcaggtgcgcggcctg
ctcgggctgttgatgttcgccgccttcggggtgttctggagcagcctggtattgctgctc
agcgcgccgccgtattcgctgtcgcacagcgccatcggcgccttcggcctggtcggcgcg
ctcggcgcgctgggcgcggcgcggaccggcagcctggccgatcgcggccacgcccaggcg
ctcagcggcggcgccctgctgctgttgctgctgtcctggctgccgctcgccctcggcacg
cattcgctggtggcactgattctcggcgtgctgctgctcgatctcgccggccaggcgatc
catgtgctcaaccagagcctggtcttcgccatcgacccgcgcgcccacagccgcctggtg
ggttgctacatgctgttctacgccgccggcagcggcctcggcgccagcgccggcaccgcc
atgtacgcctgggccggctgggacgcggtgagcctgctcggcgcggcgatcagcctggcg
gccctggcgttctggtggttcacccgtggcgttggcggcgaagcgcgtacggcctgcgcc
aacggcgcctga

DBGET integrated database retrieval system