KEGG   Pseudomonas aeruginosa MTB-1: U769_20490Help
Entry
U769_20490        CDS       T02951                                 

Definition
(GenBank) membrane protein
Organism
paem  Pseudomonas aeruginosa MTB-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TPT
Motif
Other DBs
NCBI-ProteinID: AHB57336
LinkDB All DBs
Position
complement(4432231..4433136)
Genome map
AA seq 301 aa AA seqDB search
MTRTRWFALACLILAMALWGSSYVVLKVAFRELPPLWVIFGRMALGSLVFLVAWRWRGRI
DYRSGDWKYLLGLAVCEPCLYFLCESFALQYTSAAQAGMITALLPLLVAVGAWLLLHERI
GRMTWIGFGLAVLGSIWLSLAGEPDLHAPQPLLGNFFELLAMLCATGYTLLLKHLSARYS
AFALTAMQAFVGTLFFLPLALASADLPSQPSALGIQAVVYLGVVVTVGAYGLYNFGVGRL
PASQASGFINLIPVFTLVFASLFLGETLNGPQMLAAGLVFIGVAISQWRSAPPPPPAGVL
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgactcggacgcgctggttcgccctggcctgcctgatcctggcgatggcgctgtggggc
agttcgtacgtggtgctgaaggtcgctttccgcgaactgccgccgctctgggtgatcttc
ggtcgcatggccctcggcagcctggtgttcctcgtcgcctggcgctggcggggacgcatc
gactaccgctcgggcgactggaagtacctgctcggcctggccgtctgcgaaccctgcctg
tacttcctctgcgaatccttcgccctgcaatacaccagcgcggcccaggccgggatgatt
accgcgctgctgccgttgctggtggcggtgggggcctggttgctgctgcacgaacggatc
ggccggatgacctggatcggcttcggcctggcggtgctcggttcgatctggctgagcctc
gccggcgagcccgacctgcacgcgccgcagccgctgctgggcaacttcttcgaacttctc
gcgatgctctgcgccaccggctataccctgttgctgaagcacctgtcggcgcgctactcg
gcattcgccctgaccgccatgcaggccttcgtcggcacgttgttcttcctgccgctggcg
ctggccagcgccgacctgccgagccagcccagcgcgctggggatccaggcggtggtgtat
ctcggcgtggtggtcacggtgggcgcctacggcctgtacaacttcggcgtcggtcgactg
ccggccagccaggcctcgggattcatcaacctgatcccggtcttcaccctggtattcgcc
tcgctgttcctcggcgaaaccctcaacggcccgcagatgctcgctgccggcctggtcttc
atcggcgtcgccatcagccagtggcgcagcgctccgccgccgcctccggccggcgtcctg
aactga

DBGET integrated database retrieval system