KEGG   Pseudomonas aeruginosa MTB-1: U769_24105Help
Entry
U769_24105        CDS       T02951                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
paem  Pseudomonas aeruginosa MTB-1
Pathway
paem00970  Aminoacyl-tRNA biosynthesis
paem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paem00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    U769_24105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paem03029]
    U769_24105
Enzymes [BR:paem01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     U769_24105
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     U769_24105
Mitochondrial biogenesis [BR:paem03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    U769_24105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHB58044
LinkDB All DBs
Structure
PDB: 

Position
5178480..5179934
Genome map
AA seq 484 aa AA seqDB search
MLHQLTLAEIARALADKQFSAEELTRTLLGRIRQLDPQLNSFISITDDLAIAQAKAADER
RANGENGALLGAPIAHKDLFCTQGVRTSCGSKMLDNFVSPYDATVVEKLTAAGAVTLGKL
NMDEFAMGSSNQSSHYGAVKNPWSLDRVPGGSSGGSAAAVAARLLPAATGTDTGGSIRQP
AALTNLTGIKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALMLGVMAGFDPKDSTSVE
QPVDDYLAALQKPLSGLRIGLPREYFGAGLDSRIADAVLAVVEELKTLGATVKEISLPNM
QHAIPAYYVIAPAEASSNLSRFDGVRYGYRCDAPQNLEDLYKRSRAEGFGSEVKNRIMVG
TYALSAGYYDAYYLQAQKIRRLIKNDFVSAFAEVDVILGPTTPNPAWKIGEKNDDPVSQY
LEDIYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQQVSDWHTRT
PAGF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcaattgaccctcgccgagatcgcccgcgccctcgccgacaagcaattttcc
gccgaagagctgacccgcaccctgctcggtcgcatccggcagctggatccccagctcaac
agtttcatcagcatcaccgacgacctggccatcgcccaggccaaggcagccgacgaacgg
cgcgccaacggcgagaacggcgccctgctcggcgcgccgattgcccacaaggacctgttc
tgcacccagggcgtacgcaccagctgcggttcgaagatgctcgacaacttcgtctcgccc
tacgacgccaccgtggtcgagaagctcaccgccgccggcgccgttaccctcggcaagctg
aacatggatgaattcgccatgggctcgtcgaaccagtccagccactacggcgcggtgaag
aacccctggagcctcgaccgcgtgccgggcggctcctccggcggttccgccgcggcagtc
gccgcgcgcctgctgccggccgccaccggcaccgatactggcggctcgatccgccaaccg
gcggcgctgaccaacctcaccgggatcaagccaacctacggccgggtttcccgatggggc
atgatcgcctacgcctccagcctcgaccagggcggcccgctggcgcgcaccgccgaggac
tgcgcgctgatgctgggggtgatggccggattcgatccgaaggactcgaccagcgtcgaa
cagccggtggacgactacctggccgccctgcagaagccgctgagcggcctgcgcatcggc
ctgccgcgggaatacttcggcgccggcctcgacagccgcatcgccgacgcggtgctggcc
gtggtcgaggagctgaagacgctcggcgccacggtgaaggaaatttccctgccgaacatg
cagcacgccatcccggcctactacgtaatcgcgccggccgaggcgtcctccaacctgtcg
cgcttcgacggcgtgcgctatggctatcgttgcgacgccccgcagaacctggaagacctg
tacaagcgctcgcgcgcggaaggcttcggcagcgaagtgaagaaccgcatcatggtcggc
acctacgcactctcggccggctactacgatgcctattacctgcaggctcagaagattcgc
cggctgatcaagaacgacttcgtcagcgcctttgccgaagtggacgtgatcctcggcccg
accacgccgaacccggcctggaagatcggcgagaagaacgacgacccggtttcccagtac
ctggaagacatctacaccatcaccgccaacctcgccggcctgccggggctgtccatgccc
gccggcttcgtcgacggcctgccggtgggtgtccagttgctcgcgccctacttccaggaa
ggccgcctgctcaacgtcgcgcaccagtaccagcaggtcagcgactggcacacccgcacc
ccggccggcttctaa

DBGET integrated database retrieval system