KEGG   Pseudomonas aeruginosa MTB-1: U769_26865Help
Entry
U769_26865        CDS       T02951                                 

Definition
(GenBank) major facilitator transporter
  KO
K05548  MFS transporter, AAHS family, benzoate transport protein
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paem02000]
    U769_26865
Transporters [BR:paem02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Aromatic acid:H+ symporter (AAHS) family [TC:2.A.1.15]
    U769_26865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 TRI12 MFS_5 MFS_1_like MFS_3
Motif
Other DBs
NCBI-ProteinID: AHB58592
LinkDB All DBs
Position
complement(5762441..5763781)
Genome map
AA seq 446 aa AA seqDB search
MNRQSAAAVIDAARFNRTHWLILGWGCFIMLFDGYDMVIYGSVVPRLMQEWQLSPVQAGT
LGSCALFGMLFGGTLLAPLADRFGRRRLVIATTLLASLAAFLTGHARDPLELGAGRFFTG
LALGALVPSAINLISEFAPAGRRSTLVTVMSAFYSVGAVLSALLAIAMIPAWGWQSVFYV
AVLPVLAVPLMLRWLPESAAFLELKGRRAELDALLRKVDPDYRPVAERANAVAAEAPSGR
VAQLFEGRQAVGTLLLWVAFAMCMLMSYGLNTWLPKLMAGGGYALGSSLAFLVTLNVGAT
LGALFGGWLADRLGAGRTLVLFFALAAASLAALGLGPGPWLLNGLLVVAGATTIGTLAVI
HAYAAQFYPAWVRSTGVGWAAGVGRLGAIAGPMLGGSLLALELPFQQNFLAFAAPGVIGA
LAIACIHLRPRVPAEVSVDATAKKPL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggcaatccgctgcggcggtgatcgacgctgcccgctttaaccgtactcactgg
ctgatcctcggctgggggtgtttcatcatgctgttcgacggctacgacatggtcatctac
ggctcggtggtgccacgcctgatgcaggagtggcagctgagcccggtgcaggccggcacc
ctcggcagttgcgcgctgttcggcatgctcttcggcggcaccctgctggcgccgctggcg
gaccgcttcggccggcgccgcctggtgatcgccaccaccctgctggcgagcctcgccgcc
ttcctcaccgggcacgcccgcgacccgctggaactgggcgccggacgctttttcaccggc
ctggcactgggcgcgctggtgcccagcgcgatcaacctgatcagcgaattcgccccggcc
gggcggcgcagcaccctggtcacggtgatgtcggccttctactcggtgggcgcggtgctc
tcggcgctactggcgatcgccatgatccccgcctggggctggcaatcggtgttctacgtg
gcggtgctgccggtgctggcggtgccgctgatgttgcgctggttgccggagtcggcggcg
ttcctcgaactcaagggccgccgcgccgaactggacgcgctgctgcgcaaggtcgatccc
gactaccggcccgtcgccgagcgggcgaacgctgtcgcggccgaagcgccgagcggacgg
gtcgcccagttgttcgaggggcgccaggcagtgggcaccctgttgctgtgggtggccttc
gccatgtgcatgctgatgagctacgggctcaacacctggttgccgaagctgatggccggc
ggcggctacgccctcggttcgagcctggcgttcctcgtcactctgaatgtcggggcgacc
ctcggcgcgttgttcggcggctggctggccgaccgcctcggcgccggccgcaccctggtg
ctgttcttcgccctggccgcggcctccctggcggccctcggcctggggccaggcccctgg
ctgctcaacggcctgctggtggtggccggcgccaccaccatcggcaccctggcggtgatc
catgcctacgccgcgcagttctatccggcctgggtgcgctccaccggggtcggctgggcc
gccggtgtcggccgcctcggcgccatcgccgggccgatgctcggcggcagcctgctggcc
ctggagctgccgttccagcagaacttcctggccttcgccgcgcctggcgtgatcggcgcg
ctggcgatcgcctgcatccacctgcggccgcgcgtgccggcggaagtgtccgtcgacgcg
acggcgaagaaacccctgtga

DBGET integrated database retrieval system