KEGG   Pseudomonas aeruginosa MTB-1: U769_27445Help
Entry
U769_27445        CDS       T02951                                 

Definition
(GenBank) glutamine-synthetase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
paem  Pseudomonas aeruginosa MTB-1
Brite
KEGG Orthology (KO) [BR:paem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U769_27445
Enzymes [BR:paem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     U769_27445
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     U769_27445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: AHB58706
LinkDB All DBs
Position
complement(5898073..5901021)
Genome map
AA seq 982 aa AA seqDB search
MSLPSLANLPATLLPAAERAGTALRSAVAALDAAALARLEAWPEERLEDFRRVAAASDFV
AEQAVRDPAMLLELAERGELENPHAPGELRSQLQARLEDCADEDELGRRLRRFRTRQQLR
IIWRDLTRRAALAETCRDLSALADACIDLACEWLHRRQCEQFGTPIGRRSGEPQRMVVLG
MGKLGAVELNLSSDIDLIFGYPEGGETEGAKRSLDNQEFFTRLGQKLIKALDAITVDGFV
FRVDMRLRPYGSSGPLVYSFAALEQYYQDQGRDWERYAMIKARVVGGDQQAGEQLLGMLR
PFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMSENIKLGEGGIREVEFIAQAFQLIHGGR
DLSLQQRPLLKVLATLEGQGYLPPAVVEELRGGYEFLRYAEHAIQALADRQTQMLPSDEY
DRIRVAFIMGFASWAAFHERLSHWRARIDWHFRQVIADPDEDESGEAACGSVGAEWIPLW
EEALDEESASRQLADAGFVDAEAAWKRLSDLRHGPQVRAMQRLGRERLDAFVPRLLAMTV
ENPQPDLVLERVLPLVEAVARRSAYLVLLTENPGALERLLTLCAASPMVAEQIARFPILL
DELLNEGRLFRPPQAAELAAELRERLMRIPEDDLEQQMETLRHFKLAHGLRVAASEIAGT
LPLMKVSDYLTWLAEAILVEVLELAWRQLVQRHGRPLRADGTPCDPDFVIVGYGKVGGLE
FGHGSDLDLVFIHDGDPHCETDGGKSIDGAQFFTRLGQKIIHFLTAQTPSGTLYEVDMRL
RPSGAAGLLVSSLGAFQRYQEQEAWTWEHQALVRARVLAGCRRVQASFEAVRAEVLARPR
DLDALRTEVSEMRAKMRDNLGTRATAAGTASNAFEATAAFDLKHDAGGIVDIEFMVQYAV
LAWSGEHPALLEFTDNIRILEGLERAGLIASEDVRLLQEAYKAYRAAAHRLALQKEAGVV
SGEHFQTERREVIRIWRELRLG
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgccttcgctggcgaatctgccggccaccctgctgcccgccgccgaacgcgcc
gggactgccctccgctccgctgtcgccgccctcgatgccgccgccctggcccgtctggag
gcctggcccgaggagcgcctggaggatttccgacgggtcgccgcggccagcgatttcgtc
gccgagcaggcagtgcgcgacccggcgatgctgctggaactggccgaacgcggcgagctg
gagaacccccacgcgcccggcgaactgcgcagtcagttgcaggcgcggctggaggattgc
gccgacgaggacgaactcggtcggcgcctgcgacgtttccgcacacgccagcaactgcgc
atcatctggcgcgacctgacccgccgcgccgcgctggcggaaacctgtcgcgacctgtcg
gccctggccgacgcctgcatcgacctggcttgcgagtggctccatcggcgccagtgcgag
cagttcggcacgccgatcggccggcgctccggcgaaccgcagcggatggtggtcctcggc
atgggcaagctgggcgcggtggagctcaacctgtcgtcggacatcgacctgatcttcggt
tacccggagggcggcgagaccgagggggcgaagcgttcgctggacaaccaggagttcttc
acccgcctggggcagaagctgatcaaggcgctggatgcgatcaccgtcgacggcttcgtc
ttccgcgtcgacatgcgcctgcgtccctacggctccagcggaccgctggtctacagcttc
gccgcgctggagcaatactaccaggaccaggggcgcgactgggagcgctacgcgatgatc
aaggcgcgggtggtcggcggcgaccagcaggcaggcgagcaactgctcggcatgctgcgg
ccgttcgtctatcggcgctacctggacttctccgccatcgaggcgctgcgcaccatgaag
cagctgatccagcaggaggtccggcgcaaggggatgtcggaaaacatcaagctgggcgaa
ggcggtatccgcgaggtggagttcatcgcccaggccttccagttgatccatggcgggcgc
gacctgagcttgcagcaacggccgctgctgaaggtgctggcgaccctggaggggcagggc
tacctgccgccggcggtggtcgaggagctgcgtggcggctacgagttcctgcgctacgcc
gagcatgccatccaggcgctggccgaccggcagacgcaaatgctgcccagcgacgaatac
gaccgcatccgcgtggccttcatcatgggcttcgccagttgggccgcattccacgagcgc
ctgagccactggcgggcgcgcatcgactggcacttccgccaggtgatcgccgacccggac
gaggacgaaagcggcgaggcggcctgcggcagcgtcggcgccgagtggatcccgctgtgg
gaggaggcgctggacgaggagtcggccagtcggcaactggccgacgccggcttcgtcgat
gccgaggcggcctggaagcgtctcagcgatctgcgccacggcccccaggtgcgagcgatg
cagcgtctcggccgggaacgcctggatgccttcgttccgcgcctgctggcgatgaccgtg
gaaaacccccagccggacctggtgctggagcgggtcctgccgctggtggaagcggtggcg
cggcgttccgcctacctggtgttgctgaccgagaaccccggcgcactggagcgcctgctg
accctctgcgcggccagcccgatggttgccgagcagatcgcgcggttcccgatcctgctc
gacgaactgctcaacgaggggcgcctgttccgtcctccacaggccgccgagctggccgcc
gagctgcgcgaacggctgatgcggattcccgaggacgacctcgagcagcagatggagacc
cttcgtcacttcaagctggcccacgggctgcgggtggcggcctcggagatcgccggcacg
ctgccgttgatgaaggtcagcgactacctgacctggctggccgaggcgatcctcgtcgag
gtcctcgaactggcctggcggcagttggtgcagcgtcacggccggccgttgcgcgccgac
ggcacgccgtgcgatccggacttcgtcatcgtcggctacggcaaggtcggcgggctggag
ttcggtcatggctcggacctcgacctggtgttcatccatgacggcgacccccactgcgag
accgatggcggcaaatccatcgatggcgcgcagttctttacccgtctggggcagaagatc
atccatttcctcaccgcgcagacgccatccggcaccctctacgaggtcgacatgcgcctg
cgtccgagcggcgcggccggcctgctggtgagttcgctgggcgccttccagcgctaccag
gagcaggaggcctggacctgggagcaccaggcgttggtccgcgcccgggtgctggccggt
tgccggcgggtgcaggcgagcttcgaggcggtacgtgccgaggtgctggcgaggccgcgc
gatctcgacgcgttgcgcaccgaagtcagcgaaatgcgcgccaagatgcgcgacaacctg
ggaacccgcgcgaccgccgccggtaccgcctcgaatgccttcgaggccacggcagccttc
gatctcaagcacgatgccggtggtatcgtcgatatcgaatttatggtgcaatatgcggtt
ctagcttggtccggagaacacccggcgctgctcgaattcaccgataacatccgcattctg
gaaggactggaacgggctggcctgatcgccagcgaggacgtccgtctcctgcaggaggcc
tacaaggcctatcgcgcagccgcacaccgcctggcactacagaaggaggccggggtcgtg
agcggcgagcacttccagacggagcggcgagaagtgatcaggatctggcgcgagctgcgg
ctcggctga

DBGET integrated database retrieval system