KEGG   Paenibacillus sp. FSL P4-0081: P40081_19340Help
Entry
P40081_19340      CDS       T03332                                 

Definition
(GenBank) peptidase M4
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
paen  Paenibacillus sp. FSL P4-0081
Brite
KEGG Orthology (KO) [BR:paen00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:paen01002]
    P40081_19340
Enzymes [BR:paen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     P40081_19340
Peptidases [BR:paen01002]
 Metallo Peptidases
  Family M4: thermolysin family
   P40081_19340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: AIQ30074
LinkDB All DBs
Position
complement(4346377..4347981)
Genome map
AA seq 534 aa AA seqDB search
MKKTVASLLAGVVALGSFASVGTAAENNERNNPVELFSGSSPISITDQSWKAPAGSASED
KVWGYLESVKGNLHLSAKEDIRGKFKISEQNTNSKTGSQHYRLSQYISGIPVYGADQTLH
IDKSGNVTSLLGSVVEDVYQTIPQPLIQLQTISGADAILAAEQDATLEHGPLGEPQVTPT
ADLYYFIVDGEPKLAYKTEVNVLEPEPLRIRYFISAENGSVLFKYNILENLTGTGTGVFG
DTKTFETRLSGSTYQLYDSTRGKGIVTYTAKNKTSLPGTLLTSTNNVWTDKAAVDAHTYA
ERTYDYYLQHFGRNSLDNNGLQIRSTVHYYTSYNNAFWNGAQIVFGDGDGSTFTLLSGDL
DVVGHELTHGVTEKTSNLEYYGEPGALNESFSDIIGNSIEGANWLIGDKVYTPGVAGDAL
RSLANPPLYGQPDKYSDRYTGTGDEGGVHTNSGINNKAFYLAAQGGTFSGVTVTGIGRED
AVQIYYNALVYYLTTSSNFSAARTAIIQSATELFGAGSAQVTAVTKAYNAVGVY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagactgtggcttcacttcttgcaggtgttgtagcacttggatcctttgcctcg
gtgggcactgctgctgaaaacaatgaacgcaataatcctgtagaactcttctcaggctcg
tcccctatttcgattacggaccaatcctggaaagctcctgctggctccgcttctgaggac
aaagtatggggatatcttgaaagtgttaaaggtaacctgcatctttcggctaaagaggat
attcggggaaaattcaaaatttcagagcaaaatacaaacagcaagaccggcagccagcac
taccggttaagccagtatatctcggggataccggtatatggagctgatcaaactctgcat
atcgacaaatccggcaacgttacctccctgctgggaagcgtagttgaagatgtttaccag
acgattccgcagccgctgattcagctccaaaccatttccggagcagatgctattctggca
gccgagcaggatgccacgctggaacatggaccgcttggtgagccgcaagttactcctaca
gcggatttatattatttcattgttgacggagaacctaaattagcctataaaacggaagtg
aatgttctggagcccgagcctttgcggatacggtacttcatttctgcggagaatggcagc
gtactgttcaaatataatattttagagaacctgacgggtacgggtactggagtgtttgga
gataccaaaacgttcgagacacgcctctcgggttctacctatcagctctatgacagtacc
cgcggcaagggcattgtgacgtataccgctaaaaacaagacctctcttccggggacgctc
ttaaccagcaccaacaatgtctggacagacaaagccgcggttgatgcccacacgtatgct
gaaagaacctatgattattatctccagcatttcggccgcaacagcctggacaacaacgga
ctgcagatccgttccaccgtccattactatacttcctataacaacgctttttggaacggt
gcgcaaattgttttcggtgatggagatggatctacctttacactgctgtccggtgacttg
gatgttgtgggccacgagctgacgcatggtgtaactgagaaaacatccaatcttgaatac
tatggagaaccaggggcactgaatgagtccttctccgacattatcggaaattcaattgaa
ggtgcgaactggctgatcggcgataaagtatatacaccgggtgtagcgggtgacgcactc
cgctcactggctaatcccccattgtacggacagcctgacaaatacagcgaccgctatacc
ggtaccggtgatgaaggcggtgtgcatacgaacagcgggattaataacaaagctttctat
ctggctgcccaaggcggtacgtttagcggtgtaacggtcacaggtatcggccgtgaggat
gccgttcaaatctattacaatgcacttgtatattaccttacgacctcatccaacttctct
gctgcacgcacagcaatcattcaatcggctacggaattgtttggagcaggctcggctcaa
gtaactgccgtaaccaaagcttacaatgcggtaggcgtctactaa

DBGET integrated database retrieval system