KEGG   Paenibacillus sp. FSL P4-0081: P40081_26720
Entry
P40081_26720      CDS       T03332                                 

Definition
(GenBank) sugar phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
paen  Paenibacillus sp. FSL P4-0081
Brite
KEGG Orthology (KO) [BR:paen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    P40081_26720
Enzymes [BR:paen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     P40081_26720
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AIQ31355
LinkDB
Position
complement(6003050..6004519)
AA seq 489 aa
MAIHNQVQLITYPDSLGGNLQTLNHVLDEHFSDIFKGGIHILPPFPSSGDRGFAPLTYFE
IEPAFGSWEDIKVIGEKHDVLLDVMVNHISRQSEYFQDFLRQGRRSPYADLFLTLDKVWA
DGQPVQADIGKMFLRRPLPYSTFTIGETGEEEKVWTTFGKTDPSEQIDLDIHSDQVKQLL
TDIFGNFRNNGVKIVRLDAVGYIIKKLGTSCFFVEPEIYGFLDWIRELADSLDIELLPEV
HSHYSIQYKLAERGFWIYDFILPYRILDTLVNKNAEALKEYLTTRPAKQFTMLDCHDGIP
VKPDLDGLIDTKEARKLVDACLERGANLSLIVSEGHKAEDGFDVHQIRCSYYSVLNSDDD
AYLAARAIQFFAPGIPQVYYAGLLAGENDDEAVRRTGEGREINRHNFSIDEIEQALGRGV
VQRLLALIRFRNEYGAFNGEFRVLESASHEVRLQWTKGDLRCTLHIDLAINRTVIDYAGP
EGSSVQFEV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcaattcacaatcaagtgcagctgattacgtatcccgactcgctgggcgggaacctg
cagaccctaaaccatgtgctggatgagcatttttcagatattttcaagggcggtattcat
atccttcccccgtttccctcctcgggagaccggggctttgctccgcttacttattttgag
atcgagcctgcctttggctcctgggaagatattaaggtgattggggagaaacatgatgtg
ctgctggatgtgatggttaatcatatttcccggcagtctgagtatttccaggatttcctg
agacagggaagacgctcaccgtacgctgatttgttcctgacactcgacaaggtctgggct
gacggacagcctgtgcaggccgatatcggcaaaatgtttctccgccgccccttgccctat
tccacgttcacgatcggagagacgggtgaagaggagaaggtatggacgaccttcggcaaa
accgatccctcggaacaaattgacctcgatatacattcggatcaggtaaagcaactgctg
acggatatcttcgggaatttccgtaacaacggcgtaaagattgtgcggctggatgctgta
ggttacatcatcaagaagctgggtacaagctgcttcttcgttgagcctgagatctacggg
ttcctggactggatcagggagctggccgattcgctggatatcgagttgctgccggaggtt
cattcccactacagcattcaatataaactggcggagcgcgggttctggatctatgatttc
attctgccttaccgcatccttgatacccttgtcaacaaaaatgcggaagcgctgaaagaa
tacctgactacgcgccctgcgaagcagttcacgatgctggactgtcatgacggtatcccc
gtcaagccagatctcgacggattgatcgacacgaaggaagcacgtaagctggtcgatgct
tgccttgaacgcggcgccaatctgagcctgattgtctctgagggtcataaggccgaggac
ggattcgatgtacaccagatccgctgctcctactactccgtactgaacagcgatgatgac
gcttatctggcagcccgtgccatccagttcttcgctcccggcatcccgcaggtgtattac
gccggacttctggccggagagaacgatgacgaagcggttcgccgcacaggagaagggcgg
gagattaaccgtcataacttcagtatagacgagattgagcaggcgcttggcaggggcgta
gtccagcgtctccttgcgctgatccgattccgcaacgaatacggcgcgtttaacggtgaa
ttccgcgtgctggaatcggcaagtcatgaggtccggctgcagtggaccaagggagatctg
cgctgcacactgcatattgatctggccattaaccggacggtcatcgattatgcgggaccg
gaagggtcgagtgttcagtttgaggtttga

DBGET integrated database retrieval system