KEGG   Paenibacillus sp. FSL P4-0081: P40081_31420Help
Entry
P40081_31420      CDS       T03332                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00020  Citrate cycle (TCA cycle)
paen00190  Oxidative phosphorylation
paen00650  Butanoate metabolism
paen01100  Metabolic pathways
paen01110  Biosynthesis of secondary metabolites
paen01120  Microbial metabolism in diverse environments
paen01130  Biosynthesis of antibiotics
paen01200  Carbon metabolism
Module
paen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P40081_31420 (sdhB)
   00650 Butanoate metabolism
    P40081_31420 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    P40081_31420 (sdhB)
Enzymes [BR:paen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     P40081_31420 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     P40081_31420 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_7 Fer4_2 Fer4 Fer4_15 Fer4_13 Fer4_6 Fer4_3 Fer4_16 Fer4_4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AIQ32132
LinkDB All DBs
Position
complement(7089625..7090389)
Genome map
AA seq 254 aa AA seqDB search
MAETAAAPKNVKFIITRQDEPETNPYTEEFELAYRPGMNVISALMEIQRNPVNAKGDNTV
PVCWESNCLEEVCGACSMVINGKPRQACAALIDNLEQPVRIEPMKTFPVVRDLVIDRSRM
FNALKRVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNEKTNFIG
PAAISQVRLFNAHPTGEMNSDERLEALMEDGGIDGCGNSQNCVRACPKGIPLTTSIAEIN
KQTTKHMFKRWLGV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaactgcagcagctcccaaaaacgtaaaatttatcattacccgccaagacgag
ccggaaacgaacccgtatacggaggagttcgagcttgcctaccgtccgggaatgaatgtg
atcagcgcgcttatggaaatccagcgcaatccggtgaacgcgaagggtgacaatacggtt
ccggtgtgctgggaatcgaattgtctggaggaagtatgcggcgcctgttccatggtgatc
aacggcaagccccggcaggcctgcgcagcgctgatcgataacctggagcagccggtgcgc
attgagccgatgaagaccttcccggtagtccgtgacctggtgattgaccgcagccggatg
ttcaatgccctgaagcgggttaaggcctggattccgatcgacggcacttatgatctgggt
ccgggaccccggatgccggagaagaagcgccagtgggcttatgagttatccaagtgcatg
acctgcggtgtctgcctggaggcttgcccgaatgtcaatgagaagaccaatttcatcggt
cctgcagccatctcgcaggtgcgcctgttcaacgcccaccctacaggtgagatgaactct
gatgagcgcctggaggcactgatggaagacggcggtatcgacggctgcggcaactcgcag
aactgcgtgcgcgcctgcccgaagggaattccgctgaccacctccattgccgagatcaac
aagcagacgacgaagcatatgttcaagcgctggctgggcgtgtaa

DBGET integrated database retrieval system