KEGG   Paenibacillus sp. FSL P4-0081: P40081_31425Help
Entry
P40081_31425      CDS       T03332                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00020  Citrate cycle (TCA cycle)
paen00190  Oxidative phosphorylation
paen00650  Butanoate metabolism
paen01100  Metabolic pathways
paen01110  Biosynthesis of secondary metabolites
paen01120  Microbial metabolism in diverse environments
paen01130  Biosynthesis of antibiotics
paen01200  Carbon metabolism
Module
paen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P40081_31425 (sdhA)
   00650 Butanoate metabolism
    P40081_31425 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    P40081_31425 (sdhA)
Enzymes [BR:paen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     P40081_31425 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     P40081_31425 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like FAD_oxidored GIDA NAD_binding_8 AlaDh_PNT_C DAO FAD_binding_3 CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-ProteinID: AIQ32133
LinkDB All DBs
Position
complement(7090764..7092506)
Genome map
AA seq 580 aa AA seqDB search
MASADIIIVGGGLAGLMATIKAAESGAHVHLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTK
RHRTAFAGATTGQQLLYALDEQVRRWEAEGLVTKSENWEFLSVILDDERVCRGISAQNLK
TMEIQTFPADAVILASGGPGIIFGKTTNSVINTGTAASAVYQQGVHYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPSYGNLVPRDIATREIFNVCVDQG
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKIPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECEYQYHGANRLGANSLVSAIYGGMVSGPKAVEYIKGLKKSVQDI
SSTVFDSFHKTQEDKYESLLGMTGTENAYVIHKELGEWMTANMTVVRENKKLEATIGKIK
ELKERYRNINMSDTSRWSNQGVAFTRQLWNMLELSEAMTLGALLRNESRGAHYKPEFPTR
NDEEFLKTTKAAWTPDGPQISYDEVDVSLIPPRVRDYSKD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagccgatattatcatcgtgggcggcggtctggccggcctgatggctaccatt
aaggccgccgaatccggcgcgcatgtacatctattctcactggtccctgtcaaaagatca
cattcggtctgcgcgcaaggcggcatcaatggcgcagtaaatacaaagggcgagggcgac
tcgccctgggagcattttgacgataccgtctacggcggcgacttcctggccaaccagccc
ccggtcaaagccatgtgcgaagccgcaccgggcattatccacctgatggaccggatgggc
gtcatgttcaaccgcacgccggaggggctgctcgacttccgccggttcggcgggacgaag
cgccaccggacagcgttcgccggagcgacaaccggccagcagctgctgtatgcgctggat
gagcaggtgcgccgctgggaagccgaaggcctggtgaccaagagcgagaactgggaattt
ctctccgttattctcgatgacgagcgtgtatgccgcggcatcagcgcccagaatctgaag
acgatggagattcagaccttcccggcggatgcggtcattctggccagcggcggcccgggg
attattttcggcaaaacaacgaactcggtcatcaatactggaaccgctgcaagcgctgta
tatcagcagggtgtgcattatgcgaacggggaattcatccagatccacccgacagccatc
ccgggcgatgacaagctgcggctgatgtcggaatcggcgcgcggcgaaggcggacgtatc
tggacctacaaggacggcaagccgtggtatttcctcgaagagaaatatccttcctacggc
aatctggtgccgcgcgatatcgcaacacgtgagattttcaatgtgtgtgtggatcaggga
ctgggcattaacggcgagaacatggtatacctggatctttcgcataaggacccgaaggag
ctcgacgtcaagctgggcggtattatcgagatctacgagaagttcatgggcgatgatccc
cgcaaaattccgatgaaaatcttccccgctgtgcattattcgatgggcggcatgtgggtt
gactataaccagatgacgaatattcccggcttgttcgccgcaggggaatgtgaatatcag
taccacggggcgaaccgccttggcgcgaactcgctggtatcggccatttatggcggtatg
gtctccgggccgaaggctgtggaatatatcaaggggctcaagaagtcggtgcaggatatc
tcctccacggtgttcgacagcttccacaagacgcaagaagacaaatatgagtctctgctg
gggatgacaggcacggagaatgcttacgtaatccacaaggagcttggcgaatggatgacg
gctaacatgaccgtggtgcgtgagaacaagaagcttgaagcgaccatcggcaaaatcaaa
gagctgaaggaacgctaccgcaacattaacatgagcgacacttcacgctggagcaaccag
ggcgttgccttcacgcgccagctgtggaatatgctggagctgtcagaagcaatgaccctc
ggagcgctgctgcgcaacgagagccggggggcgcattacaagccggagttcccgacgcgc
aatgatgaggaattcctcaagacgaccaaagccgcctggacgcctgacggcccgcaaatc
tcatacgacgaagtcgatgtctcgctgattcctccgcgggtccgggattactcgaaggac
tga

DBGET integrated database retrieval system