KEGG   Paenibacillus sp. FSL P4-0081: P40081_32180Help
Entry
P40081_32180      CDS       T03332                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00010  Glycolysis / Gluconeogenesis
paen00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P40081_32180
   00500 Starch and sucrose metabolism
    P40081_32180
Enzymes [BR:paen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     P40081_32180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIQ32256
LinkDB All DBs
Position
7272840..7274255
Genome map
AA seq 471 aa AA seqDB search
MSIKFPEGFLWGGAVAANQLEGAYNEDGKGWSTQDVAPQGIKGPITEVPTEDNMKLVGID
FYHRYKEDVKLFAEMGFKVFRTSIAWSRIFPNGDELEPNEQGLQFYDDLFDELHKYGIEP
LVTLSHYETPLHLSKQYNGWVNRDLVGFYERYARTVFTRYKNKVKYWLTFNEINSILHEP
FMSGGIYTPKEQLSKQDLYQAIHHELVASALAVKIGHEINPQSQIGCMILSMPTYPLTPN
PDDVIAAMKSEHMNYFFGDVHARGVYPGYMKRYFREKGIEIHMEPGDAEILKHTVDFISF
SYYVSICETGDENKRNQTEGNLFSGAANPYLKASEWGWQIDPQGLRYVLNMFHDRYQKPL
FIVENGLGAKDELITGEDGIPTVNDDYRIGYLNDHLVQVGEAIEDGVDVMGYTSWGCIDL
VSASTAQLSKRYGFIYVDRHDDNTGTLERYRKKSFHWYKDVIASNGESLQR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaagtttcctgaaggcttcctgtggggcggcgctgtagctgccaaccagctt
gaaggcgcatataacgaggacggcaaaggctggtcgacccaggacgtcgctccgcaaggg
atcaaaggtccgattactgaagttccgactgaagataatatgaagctggtcggaatcgac
ttttaccaccggtacaaagaggatgtgaagctttttgccgaaatgggcttcaaagtcttc
cgtacctctattgcctggtcgcggattttcccgaacggtgatgagctggagcctaatgag
caaggcctgcagttctatgatgatctgttcgacgagctgcataagtacggcatcgagccg
cttgttaccctctcccactacgaaacaccgctgcatttgtccaagcagtataacggctgg
gttaaccgcgatttagtcggcttctacgaacggtatgccagaacggtatttacccgctac
aagaacaaagtgaaatattggctgaccttcaacgagatcaactccattctgcatgaaccg
ttcatgagcggtggtatttacacgccgaaggagcagctcagcaagcaggacctgtaccag
gcaattcatcacgagctggtagcaagtgcactcgccgtgaagattggtcatgagatcaac
ccgcagtcccagatcggctgtatgatccttagtatgccgacttatccgctcactccgaac
ccggatgatgtaatcgcagcgatgaagtcggagcatatgaattatttcttcggggatgtt
catgcgagaggcgtatatccgggctatatgaagcgttacttcagagagaaaggcattgaa
atccatatggagcctggcgatgccgagattctgaagcacacggtagacttcatctccttc
agctactatgtgagcatctgtgagacgggagacgagaataagcgcaaccagaccgaaggc
aacctgttcagcggtgcagccaatccttacctgaaggcttccgaatggggctggcagatt
gacccgcagggcctgcgttatgtgctgaacatgttccatgaccgttaccagaagccgttg
tttatcgtcgaaaatggtctcggcgccaaggacgagctgatcaccggcgaagacggcata
ccgaccgtcaatgacgactaccggattgggtacctgaatgaccacctggtgcaggtgggc
gaagcaatcgaggacggcgtagatgtcatgggctacacctcatggggctgtattgacctg
gtcagcgcttcaaccgcacagctcagcaaacgttacggcttcatttatgtagaccgccac
gatgacaataccggcacacttgagcgctaccgcaagaaatccttccactggtataaggac
gttattgcgtccaatggagagagcttgcagcgctaa

DBGET integrated database retrieval system